Result : P23171
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized glutaredoxin-like 8.6 kDa protein in rubredoxin operon (ORF B) |
| NCBI Accession ID | M60116.1 |
| Organism | Clostridium pasteurianum |
| Left | 1126 |
| Right | 1353 |
| Strand | + |
| Nucleotide Sequence | ATGATTAAAATATATTCCACACCAACATGTCCATGGTGTAAAAAGACAAAAGAATATTTAAAATCAAAAAATATAGATTTTGTTGATGTAAATGTAGCTGATGATATGAAGGAAAGAGAAGAAATGCGTAGCTTATCCAAGCAATCAGGAGTGCCAGTTATAAATATAGATGGTAATATAATAGTTGGATTTAACAAGGCAGAAATAGATAAACTAATAGAGAAATAG |
| Sequence | MIKIYSTPTCPWCKKTKEYLKSKNIDFVDVNVADDMKEREEMRSLSKQSGVPVINIDGNIIVGFNKAEIDKLIEK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 1637309 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | P23171 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4065172 | 4065399 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 2 | 2911880 | 2912110 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 3 | 3348074 | 3348301 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 4 | 1439417 | 1439650 | - | NZ_HG917868.1 | Clostridium bornimense |
| 5 | 1585529 | 1585756 | + | NC_008593.1 | Clostridium novyi NT |
| 6 | 1976681 | 1976908 | - | NZ_CP023671.1 | Clostridium septicum |
| 7 | 720262 | 720447 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 8 | 213667 | 213894 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 9 | 247357 | 247590 | - | NZ_CP014204.2 | Clostridium baratii |
| 10 | 247084 | 247308 | + | NZ_CP014204.2 | Clostridium baratii |
| 11 | 3007642 | 3007869 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 12 | 220105 | 220332 | - | NZ_CP016786.1 | Clostridium isatidis |
| 13 | 1808707 | 1808940 | - | NZ_CP016786.1 | Clostridium isatidis |
| 14 | 3568550 | 3568777 | + | NZ_CP030775.1 | Clostridium butyricum |
| 15 | 3568840 | 3569067 | - | NZ_CP030775.1 | Clostridium butyricum |
| 16 | 1370750 | 1370977 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 17 | 203668 | 203895 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 18 | 203344 | 203571 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 19 | 1870414 | 1870641 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 20 | 2371553 | 2371780 | - | NZ_CP020953.1 | Clostridium drakei |
| 21 | 161265 | 161492 | - | NZ_CP043998.1 | Clostridium diolis |
| 22 | 683748 | 683975 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 23 | 929282 | 929524 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 24 | 188852 | 189082 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 25 | 1012138 | 1012365 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 26 | 3247037 | 3247267 | - | NZ_CP040924.1 | Clostridium thermarum |
| 27 | 1373445 | 1373672 | + | NZ_CP028842.1 | Clostridium botulinum |
| 28 | 1696983 | 1697228 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 29 | 1242005 | 1242247 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 30 | 2353458 | 2353688 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 31 | 1271247 | 1271489 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 32 | 1377609 | 1377836 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 33 | 1003021 | 1003257 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 34 | 36495 | 36740 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 35 | 1576697 | 1576882 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 36 | 1198190 | 1198429 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 37 | 1297644 | 1297889 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 38 | 1090983 | 1091222 | - | NZ_LS974202.1 | Mesotoga infera |
| 39 | 586674 | 586916 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 40 | 386457 | 386687 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 41 | 1394894 | 1395130 | - | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 42 | 1766474 | 1766716 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 43 | 1497997 | 1498239 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 44 | 1620402 | 1620623 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 45 | 1405438 | 1405680 | - | NC_011653.1 | Thermosipho africanus TCF52B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013019.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.71 | 29 | 50 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF00070.29 | 0.66 | 27 | 47.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
++ More..