Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit VIII |
NCBI Accession ID | X66864.1 |
Organism | Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) |
Left | 257 |
Right | 397 |
Strand | + |
Nucleotide Sequence | ATGGCAACTGCATTTTTGCCTTCTATCTTGGCTGACGCTTCTTTCTTGTCCTCTATCTTCGTTCCCGTAATCGGTTGGGTTGTACCAATTGCCACCTTCTCGTTTCTATTTTTATATATTGAAGGCGAAGACGTTGCTTAA |
Sequence | MATAFLPSILADASFLSSIFVPVIGWVVPIATFSFLFLYIEGEDVA |
Source of smORF | Swiss-Prot |
Function | May help in the organization of the PsaL subunit. |
Pubmed ID | 1463834 25197444 1908790 |
Domain | CDD:279175,CDD:355705 |
Functional Category | Others |
Uniprot ID | P23079 |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3586584 | 3586724 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
2 | 4428438 | 4428587 | + | NZ_CP031941.1 | Nostoc sphaeroides |
3 | 1312164 | 1312304 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
4 | 2275148 | 2275288 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
5 | 2691871 | 2692011 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00284.22 | 0.8 | 4 | 662.5 | opposite-strand | Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit |
2 | PF00283.21 | 0.8 | 4 | 625.0 | opposite-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
3 | PF14870.8 | 0.8 | 4 | 1072.0 | opposite-strand | Photosynthesis system II assembly factor YCF48 |
4 | PF00301.22 | 0.8 | 4 | 2249.0 | opposite-strand | Rubredoxin |