| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin ParD |
| NCBI Accession ID | L40585.1 |
| Organism | Escherichia coli |
| Left | 9151 |
| Right | 9402 |
| Strand | + |
| Nucleotide Sequence | ATGAGCCGCCTGACAATCGACATGACGGACCAGCAGCACCAGAGCCTGAAAGCCCTGGCCGCCTTGCAGGGCAAGACCATTAAGCAATACGCCCTCGAACGTCTGTTCCCCGGTGACGCTGATGCCGATCAGGCATGGCAGGAACTGAAAACCATGCTGGGGAACCGCATCAACGATGGGCTTGCCGGCAAGGTGTCCACCAAGAGCGTCGGCGAAATTCTTGATGAAGAACTCAGCGGGGATCGCGCTTGA |
| Sequence | MSRLTIDMTDQQHQSLKALAALQGKTIKQYALERLFPGDADADQAWQELKTMLGNRINDGLAGKVSTKSVGEILDEELSGDRA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system involved in plasmid partition. Inhibits the anti-DNA gyrase activity of toxin ParE; reverses and restores gyrase catalytic activity in vitro. The parDE operon alone is capable of stabilizing an RK2-derived minireplicon under defined growth conditions in several different Gram-negative bacteria. It does so by the post-segregational killing (PSK) of plasmid-free cells, also referred to as a plasmid addiction system. Binds its own promoter, autorepressing it; gentically only ParD is required for full autorepression. {ECO:0000269|Pubmed:12010492, ECO:0000269|Pubmed:1459960, ECO:0000269|Pubmed:8133518, ECO:0000269|Pubmed:8631720}. |
| Pubmed ID | 2172207 8387603 1459960 8262949 8133518 8631720 10661868 12010492 11743881 17656583 |
| Domain | CDD:401367 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P22995 |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 592924 | 593175 | - | NZ_CP043575.1 | Comamonas koreensis |
| 2 | 1560900 | 1561151 | + | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 3 | 4943653 | 4943904 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 4 | 4883440 | 4883694 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 5 | 49492 | 49734 | + | NZ_CP020910.1 | Rhizobium etli |
| 6 | 4301036 | 4301287 | + | NC_017964.1 | Advenella kashmirensis WT001 |
| 7 | 466702 | 466953 | - | NZ_CP053627.1 | Xylella taiwanensis |
| 8 | 174567 | 174818 | - | NZ_CP059897.1 | Ciceribacter thiooxidans |
| 9 | 1075974 | 1076225 | - | NZ_CP031555.1 | Thalassospira indica |
| 10 | 298774 | 299025 | + | NZ_CP071606.1 | Rhizobium binae |
| 11 | 293029 | 293280 | + | NZ_CP024199.1 | Thalassospira marina |
| 12 | 1412921 | 1413172 | - | NZ_CP054028.1 | Rhizobium hidalgonense |
| 13 | 2834974 | 2835228 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 14 | 121461 | 121712 | + | NZ_CP049243.1 | Rhizobium pseudoryzae |
| 15 | 329405 | 329659 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 16 | 1739632 | 1739883 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 17 | 2748978 | 2749232 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 18 | 507923 | 508177 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 19 | 73173 | 73427 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 20 | 4446762 | 4447016 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 21 | 1002993 | 1003247 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 22 | 1400266 | 1400520 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 23 | 255092 | 255355 | - | NZ_CP022746.1 | Sphingobium xenophagum |
| 24 | 2974920 | 2975174 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 25 | 5373635 | 5373892 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.72 | 18 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |