Result : P22904
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 9.0 kDa protein in mobE 3'region (ORF 8) |
| NCBI Accession ID | L37364.1 |
| Organism | Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans) |
| Left | 263 |
| Right | 520 |
| Strand | + |
| Nucleotide Sequence | ATGACTACCAAACGCAAAGTCGAAGTTTTCAGCGCGGGATGCCCCTCCTGCCAGACCGCCATTGAACTCGTCAATCGCCTCGCATGCGGTTCGTGCGAGGTCTCAATCCTCGATATGAACGACATCAATGTGGCCAAACGCGCCCGTGATCTCGGTGTTCGGTCGGTGCCGGCGGTCGCCATCAACGGCCAGCTGGCTTCGTGCTGCTCCGGCAGCGGCATCGAGGAACAGGCGCTTCGCTGGCCTCGGCAAGCCTAG |
| Sequence | MTTKRKVEVFSAGCPSCQTAIELVNRLACGSCEVSILDMNDINVAKRARDLGVRSVPAVAINGQLASCCSGSGIEEQALRWPRQA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 1400173 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | P22904 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 372176 | 372439 | - | NZ_CP019038.1 | Massilia putida |
| 2 | 956411 | 956677 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 3 | 4127236 | 4127502 | + | NZ_CP036275.1 | Maioricimonas rarisocia |
| 4 | 5173024 | 5173293 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 5 | 1570675 | 1570941 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014879.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09278.13 | 1.0 | 5 | 247 | same-strand | MerR, DNA binding |
| 2 | PF13411.8 | 1.0 | 5 | 247 | same-strand | MerR HTH family regulatory protein |
| 3 | PF00376.25 | 1.0 | 5 | 247 | same-strand | MerR family regulatory protein |
| 4 | PF03203.16 | 0.6 | 3 | 17 | same-strand | MerC mercury resistance protein |
++ More..