Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 9.0 kDa protein in mobE 3'region (ORF 8) |
NCBI Accession ID | L37364.1 |
Organism | Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans) |
Left | 263 |
Right | 520 |
Strand | + |
Nucleotide Sequence | ATGACTACCAAACGCAAAGTCGAAGTTTTCAGCGCGGGATGCCCCTCCTGCCAGACCGCCATTGAACTCGTCAATCGCCTCGCATGCGGTTCGTGCGAGGTCTCAATCCTCGATATGAACGACATCAATGTGGCCAAACGCGCCCGTGATCTCGGTGTTCGGTCGGTGCCGGCGGTCGCCATCAACGGCCAGCTGGCTTCGTGCTGCTCCGGCAGCGGCATCGAGGAACAGGCGCTTCGCTGGCCTCGGCAAGCCTAG |
Sequence | MTTKRKVEVFSAGCPSCQTAIELVNRLACGSCEVSILDMNDINVAKRARDLGVRSVPAVAINGQLASCCSGSGIEEQALRWPRQA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
Pubmed ID | 1400173 |
Domain | CDD:412351 |
Functional Category | Others |
Uniprot ID | P22904 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 372176 | 372439 | - | NZ_CP019038.1 | Massilia putida |
2 | 956411 | 956677 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
3 | 4127236 | 4127502 | + | NZ_CP036275.1 | Maioricimonas rarisocia |
4 | 5173024 | 5173293 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
5 | 1570675 | 1570941 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09278.13 | 1.0 | 5 | 247 | same-strand | MerR, DNA binding |
2 | PF13411.8 | 1.0 | 5 | 247 | same-strand | MerR HTH family regulatory protein |
3 | PF00376.25 | 1.0 | 5 | 247 | same-strand | MerR family regulatory protein |
4 | PF03203.16 | 0.6 | 3 | 17 | same-strand | MerC mercury resistance protein |