Result : P22755
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SinI |
| NCBI Accession ID | M60287.1 |
| Organism | Bacillus licheniformis |
| Left | 95 |
| Right | 271 |
| Strand | + |
| Nucleotide Sequence | ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCATTAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATTCAATAAATCCTTTCTGA |
| Sequence | MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF |
| Source of smORF | Swiss-Prot |
| Function | Acts as an antagonist to SinR. SinI prevents SinR from binding to its target sequence on the gene for AprE (By similarity). {ECO:0000250}. |
| Pubmed ID | 2121898 |
| Domain | CDD:400831 |
| Functional Category | Others |
| Uniprot ID | P22755 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2703845 | 2704021 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 2 | 2550484 | 2550660 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 3 | 2825673 | 2825849 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 2521624 | 2521797 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2349676 | 2349849 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3704720 | 3704893 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2425398 | 2425571 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2552446 | 2552619 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 9 | 2426637 | 2426810 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 10 | 2412199 | 2412372 | + | NZ_CP013984.1 | Bacillus inaquosorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023665.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02347.18 | 1.0 | 10 | 4234.0 | opposite-strand | Glycine cleavage system P-protein |
| 2 | PF01571.23 | 1.0 | 10 | 3116.0 | opposite-strand | Aminomethyltransferase folate-binding domain |
| 3 | PF08669.13 | 1.0 | 10 | 3116.0 | opposite-strand | Glycine cleavage T-protein C-terminal barrel domain |
| 4 | PF00176.25 | 1.0 | 10 | 998.0 | same-strand | SNF2-related domain |
| 5 | PF00271.33 | 1.0 | 10 | 998.0 | same-strand | Helicase conserved C-terminal domain |
| 6 | PF04851.17 | 1.0 | 10 | 998.0 | same-strand | Type III restriction enzyme, res subunit |
| 7 | PF00270.31 | 1.0 | 10 | 998.0 | same-strand | DEAD/DEAH box helicase |
| 8 | PF11079.10 | 1.0 | 10 | 185.0 | same-strand | Bacterial protein YqhG of unknown function |
| 9 | PF01381.24 | 1.0 | 10 | 28.0 | same-strand | Helix-turn-helix |
| 10 | PF08671.12 | 1.0 | 10 | 28.0 | same-strand | Anti-repressor SinI |
| 11 | PF12844.9 | 1.0 | 10 | 28.0 | same-strand | Helix-turn-helix domain |
| 12 | PF13560.8 | 1.0 | 10 | 28.0 | same-strand | Helix-turn-helix domain |
| 13 | PF13443.8 | 1.0 | 10 | 28.0 | same-strand | Cro/C1-type HTH DNA-binding domain |
| 14 | PF12389.10 | 1.0 | 10 | 463.5 | opposite-strand | Camelysin metallo-endopeptidase |
| 15 | PF13028.8 | 1.0 | 10 | 2900.5 | same-strand | Protein of unknown function (DUF3889) |
++ More..