Result : A5A619
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YojO |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2303606 |
| Right | 2303770 |
| Strand | + |
| Nucleotide Sequence | ATGCATACCCCGATCGGGGTAAAACCTGTAGCAGGATCAAAAGAGTGGCGGGAAGCGTGGCAAAAACGGGCTTTTGCTCACATTTCAAATGGTTATAAATATATTTATATAGCGATTGATTCACCAGAGATATTTCTGCTGGTTTGCTCTCTCATTAGAATTTAA |
| Sequence | MHTPIGVKPVAGSKEWREAWQKRAFAHISNGYKYIYIAIDSPEIFLLVCSLIRI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A5A619 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2303606 | 2303770 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2325606 | 2325770 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3037294 | 3037458 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2794039 | 2794203 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12801.9 | 1.0 | 3 | 4028.0 | opposite-strand | 4Fe-4S binding domain |
| 2 | PF13187.8 | 1.0 | 3 | 2068.5 | opposite-strand | 4Fe-4S dicluster domain |
| 3 | PF13237.8 | 1.0 | 3 | 2068.5 | opposite-strand | 4Fe-4S dicluster domain |
| 4 | PF12837.9 | 1.0 | 3 | 2068.5 | opposite-strand | 4Fe-4S binding domain |
| 5 | PF14697.8 | 1.0 | 3 | 3346.0 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF12838.9 | 1.0 | 3 | 1727.5 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF12797.9 | 1.0 | 3 | 1727.5 | opposite-strand | 4Fe-4S binding domain |
| 8 | PF00384.24 | 1.0 | 3 | 853.0 | opposite-strand | Molybdopterin oxidoreductase |
| 9 | PF01568.23 | 1.0 | 3 | 853.0 | opposite-strand | Molydopterin dinucleotide binding domain |
| 10 | PF04879.18 | 1.0 | 3 | 853.0 | opposite-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 11 | PF10518.11 | 1.0 | 3 | 853.0 | opposite-strand | TAT (twin-arginine translocation) pathway signal sequence |
| 12 | PF03927.15 | 1.0 | 3 | 593.0 | opposite-strand | NapD protein |
| 13 | PF00037.29 | 1.0 | 3 | 109.0 | opposite-strand | 4Fe-4S binding domain |
| 14 | PF03974.15 | 1.0 | 3 | 134.5 | same-strand | Ecotin |
| 15 | PF06039.17 | 0.67 | 2 | 998 | opposite-strand | Malate:quinone oxidoreductase (Mqo) |
| 16 | PF00005.29 | 1.0 | 3 | 2749.0 | opposite-strand | ABC transporter |
| 17 | PF13532.8 | 0.67 | 2 | 4581 | opposite-strand | 2OG-Fe(II) oxygenase superfamily |
++ More..