Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 8.8 kDa protein in aacA4 3'region (ORF 3) |
NCBI Accession ID | M21682.1 |
Organism | Klebsiella pneumoniae |
Left | 749 |
Right | 994 |
Strand | - |
Nucleotide Sequence | ATGGAAGGGTTAGGCAACACTGCGTGTTCGCTCGAATGCCTGGCGTGTTTGAACCATGTACACGGCTGGACCATCTGGGGTGGTTACGGTACCTTGCCTCTCAAACCCCGCTTTCTCGTAGCATCGGATCGCTCGCAAGTTGCTCGGCGACGGGTCCGTTTGGATCTTGGTGACCTCGGGATCATTGAACAGCAACTCAACCAGAGCTCGAACCAGCTTGGTTCCCAAGCCTTTGCCCAGTTGTGA |
Sequence | MEGLGNTACSLECLACLNHVHGWTIWGGYGTLPLKPRFLVASDRSQVARRRVRLDLGDLGIIEQQLNQSSNQLGSQAFAQL |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 2841303 |
Domain | |
Functional Category | Others |
Uniprot ID | P21423 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4554114 | 4554359 | - | NZ_CP031123.2 | Providencia huaxiensis |
2 | 567301 | 567546 | - | NZ_CP043575.1 | Comamonas koreensis |
3 | 565998 | 566243 | - | NZ_CP043575.1 | Comamonas koreensis |
4 | 8049 | 8294 | - | NZ_CP031121.1 | Providencia huaxiensis |
5 | 100277 | 100522 | - | NZ_CP048797.1 | Providencia vermicola |
6 | 42483 | 42728 | - | NZ_CP031122.1 | Providencia huaxiensis |
7 | 48288 | 48533 | + | NZ_CP022359.1 | Shewanella bicestrii |
8 | 132682 | 132927 | - | NZ_CP061512.1 | Mixta calida |
9 | 81824 | 82069 | + | NZ_CP029396.2 | Acinetobacter defluvii |
10 | 1772659 | 1772904 | + | NZ_CP020121.1 | Comamonas kerstersii |
11 | 1773914 | 1774159 | + | NZ_CP020121.1 | Comamonas kerstersii |
12 | 3266348 | 3266593 | - | NZ_CP040449.1 | Aeromonas simiae |
13 | 3263223 | 3263420 | - | NZ_CP040449.1 | Aeromonas simiae |
14 | 752562 | 752807 | + | NZ_CP014646.1 | Thauera humireducens |
15 | 4495129 | 4495374 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
16 | 81766 | 82011 | + | NZ_CP056080.1 | Rothia nasimurium |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13495.8 | 0.82 | 9 | 1082 | same-strand | Phage integrase, N-terminal SAM-like domain |
2 | PF13523.8 | 0.91 | 10 | -236 | opposite-strand | Acetyltransferase (GNAT) domain |
3 | PF00583.27 | 0.91 | 10 | -236.0 | opposite-strand | Acetyltransferase (GNAT) family |
4 | PF13302.9 | 0.91 | 10 | -236 | opposite-strand | Acetyltransferase (GNAT) domain |