Result : P21344
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transcriptional regulatory protein SenS |
| NCBI Accession ID | M34826.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1486 |
| Right | 1683 |
| Strand | + |
| Nucleotide Sequence | ATGGGAGTCAAAAAAGAAAAGGGGAGAAAACGATTCAGGAAGCGAAAAACCTACGGGAATCAGATTTTGCCGCTTGAGCTGCTGATTGAAAAAAACAAACGAGAGATTATAAACAGCGCGGAACTCATGGAAGAAATTTATATGAAGATTGATGAGAAGCATACGCAATGTGTAACTAAATATAAAAAAACCCGCTGA |
| Sequence | MGVKKEKGRKRFRKRKTYGNQILPLELLIEKNKREIINSAELMEEIYMKIDEKHTQCVTKYKKTR |
| Source of smORF | Swiss-Prot |
| Function | Regulates the expression of extracellular-protein genes of Bacillus subtilis. |
| Pubmed ID | 2108127 9202460 9384377 |
| Domain | CDD:387731 |
| Functional Category | DNA-binding |
| Uniprot ID | P21344 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 959311 | 959508 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 892062 | 892259 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 938253 | 938432 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 928634 | 928813 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07070.13 | 1.0 | 4 | 3681.5 | opposite-strand | SpoOM protein |
| 2 | PF03575.19 | 1.0 | 4 | 2213.5 | same-strand | Peptidase family S51 |
| 3 | PF01964.20 | 1.0 | 4 | 132.5 | same-strand | Radical SAM ThiC family |
| 4 | PF13667.8 | 1.0 | 4 | 132.5 | same-strand | ThiC-associated domain |
| 5 | PF00199.21 | 1.0 | 4 | 35.5 | opposite-strand | Catalase |
| 6 | PF06628.14 | 1.0 | 4 | 35.5 | opposite-strand | Catalase-related immune-responsive |
| 7 | PF00005.29 | 1.0 | 4 | 1767.0 | same-strand | ABC transporter |
| 8 | PF00004.31 | 0.75 | 3 | 1777 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 9 | PF13401.8 | 0.75 | 3 | 1777 | same-strand | AAA domain |
| 10 | PF09084.13 | 1.0 | 4 | 2681.0 | same-strand | NMT1/THI5 like |
| 11 | PF13379.8 | 1.0 | 4 | 2681.0 | same-strand | NMT1-like family |
| 12 | PF04069.14 | 1.0 | 4 | 2681.0 | same-strand | Substrate binding domain of ABC-type glycine betaine transport system |
| 13 | PF00528.24 | 1.0 | 4 | 3676.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 14 | PF00296.22 | 1.0 | 4 | 4529.0 | same-strand | Luciferase-like monooxygenase |
| 15 | PF07875.14 | 0.75 | 3 | 3028 | opposite-strand | Coat F domain |
++ More..