Result : P21320
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DinI-like protein in retron EC67 |
| NCBI Accession ID | |
| Organism | Escherichia coli |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRIEIMIDKEQKISQSTLDALESELYRNLRPLYPKTVIRIRKGSSNGVELTGLQLDEERKQVMKIMQKVWEDDSWLH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11630. Profile Description: DinI-like family. DNA damage-inducible protein I; Provisional |
| Pubmed ID | 1701261 |
| Domain | CDD:416342 |
| Functional Category | Others |
| Uniprot ID | P21320 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1781645 | 1781878 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 2 | 2869687 | 2869920 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 886773 | 887006 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 3122753 | 3122986 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 661311 | 661544 | + | NZ_CP054254.1 | Klebsiella variicola |
| 6 | 690292 | 690525 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 7 | 4233744 | 4233977 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 8 | 692395 | 692628 | + | NC_017554.1 | Pantoea ananatis PA13 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03237.17 | 0.75 | 6 | 3889.5 | opposite-strand | Terminase large subunit, T4likevirus-type, N-terminal |
| 2 | PF17289.4 | 0.75 | 6 | 3889.5 | opposite-strand | Terminase RNaseH-like domain |
| 3 | PF06056.14 | 0.75 | 6 | 3889.5 | opposite-strand | Putative ATPase subunit of terminase (gpP-like) |
| 4 | PF05929.13 | 0.62 | 5 | 5791 | same-strand | Phage capsid scaffolding protein (GPO) serine peptidase |
| 5 | PF05840.15 | 0.88 | 7 | 352 | same-strand | Bacteriophage replication gene A protein (GPA) |
| 6 | PF02086.17 | 0.75 | 6 | 2767.5 | same-strand | D12 class N6 adenine-specific DNA methyltransferase |
| 7 | PF01258.19 | 0.88 | 7 | 3617 | same-strand | Prokaryotic dksA/traR C4-type zinc finger |
| 8 | PF10809.10 | 0.75 | 6 | 3842.0 | same-strand | Protein of unknown function (DUF2732) |
++ More..