Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein ORFD in retron EC67 |
NCBI Accession ID | M55249.1 |
Organism | Escherichia coli |
Left | 2522 |
Right | 2824 |
Strand | + |
Nucleotide Sequence | ATGACAAGGGCAGTGCGTATCCATCAATTAAAAATTGCACCTAAGTATTTCAACGCTGTGGTTGCAGGTCAAAAGACGGCTGAACTTCGTAAAGACGATCGTGGCTATAAAGTTGGTGATGTTCTTTCTCTTTGCGAATGGAAGCATGGCGTATTTACGGGTAGGGAATGGGCCGCTGTTATCTCTCATGTGCTTCCGGTTAATGACGTCATGGCAGTTTCAGAACAATGGGTGATGCTATCAATTCGCCCATTAACCCCATTAGAAGCTTTAGGATATGTTATTGCAGGAGGTGCTGTATGA |
Sequence | MTRAVRIHQLKIAPKYFNAVVAGQKTAELRKDDRGYKVGDVLSLCEWKHGVFTGREWAAVISHVLPVNDVMAVSEQWVMLSIRPLTPLEALGYVIAGGAV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01020. Profile Description: N/A. The search results from NCBI sequence alignment indicates a conserved domain belonging to ASCH superfamily. Dali searching results show that the protein is a structurally similar to the PUA domain, suggesting it may be involved in RNA recognition. It has been reported that the deletion of PUA genes results in impaired growth (RluD) and competitive disadvantage (TruB) in Escherichia coli. Suggestions have been put forward that, apart from their usual catalytic role, certain PUS enzymes (e.g. TruB) may also act as chaperones for RNA folding. The interface interaction indicates that the biomolecule of protein NP_809782.1 should be a dimer. |
Pubmed ID | 1701261 |
Domain | CDD:412704 |
Functional Category | Others |
Uniprot ID | P21318 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3589682 | 3590002 | - | NZ_CP028271.1 | Mixta intestinalis |
2 | 3856215 | 3856472 | - | NZ_AP023184.1 | Buttiauxella agrestis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05840.15 | 1.0 | 2 | 816.0 | same-strand | Bacteriophage replication gene A protein (GPA) |
2 | PF02086.17 | 1.0 | 2 | -12.0 | same-strand | D12 class N6 adenine-specific DNA methyltransferase |