Result : P19778

Protein Information

• Protein name: Insertion element IS2 uncharacterized 11.1 kDa protein (ORF3)
• NCBI Accession ID: V00279.1
• Organism: Escherichia coli
• Left: 616
• Right: 909
• Strand: -
• Nucleotide Sequence: GTGCGCAGTTGCACGTCATTCTCAGACGAACCGATGACTGGATGGATGGCCGCCGCAGTCGTCACACTGATGATACGGATGTGCTTCTCCGTATACACCATGTTATCGGAGAGCTGCCAACGTATGGTTATCGTCGGGTATGGGCGCTGCTTCGCAGACAGGCAGAACTTGATGGTATGCCTGCGATCAATGCCAAACGTGTTTACCGGATCATGCGCCAGAATGCGCTGTTGCTTGAGCGAAAACCTGCTGTACCGCCATCGAAACGGGCACATACAGGCAGAGTGGCCGTGA
• Sequence: MRSCTSFSDEPMTGWMAAAVVTLMIRMCFSVYTMLSESCQRMVIVGYGRCFADRQNLMVCLRSMPNVFTGSCARMRCCLSENLLYRHRNGHIQAEWP
• Source of smORF: Swiss-Prot
• Pubmed ID: 2830172
• Functional Category: Others
• Uniprot ID: P19778
• ORF Length (Amino Acid): 97

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	381747	382040	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	2996911	2997204	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	2069491	2069784	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
4	1468460	1468753	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
5	3186583	3186876	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
6	4498668	4498961	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
7	87549	87842	-	NC_004851.1	Shigella flexneri 2a str. 301
8	170812	171105	-	NC_004851.1	Shigella flexneri 2a str. 301
9	4289767	4290060	-	NZ_CP061527.1	Shigella dysenteriae
10	3982742	3983035	-	NZ_CP061527.1	Shigella dysenteriae
11	555258	555551	+	NZ_CP061527.1	Shigella dysenteriae
12	3795143	3795436	-	NZ_CP061527.1	Shigella dysenteriae
13	853311	853604	+	NZ_CP061527.1	Shigella dysenteriae
14	1013663	1013956	+	NZ_CP061527.1	Shigella dysenteriae
15	1114637	1114930	+	NZ_CP061527.1	Shigella dysenteriae
16	3273649	3273942	-	NZ_CP061527.1	Shigella dysenteriae
17	3157981	3158274	-	NZ_CP061527.1	Shigella dysenteriae
18	2847472	2847765	-	NZ_CP061527.1	Shigella dysenteriae
19	1633598	1633891	+	NZ_CP061527.1	Shigella dysenteriae
20	2606030	2606323	-	NZ_CP061527.1	Shigella dysenteriae
21	2529093	2529386	-	NZ_CP061527.1	Shigella dysenteriae
22	2386952	2387245	-	NZ_CP061527.1	Shigella dysenteriae
23	2097685	2097978	+	NZ_CP061527.1	Shigella dysenteriae
24	1968459	1968752	-	NZ_CP061527.1	Shigella dysenteriae
25	2591955	2592248	+	NZ_CP061527.1	Shigella dysenteriae
26	2650753	2651046	+	NZ_CP061527.1	Shigella dysenteriae
27	1571279	1571572	-	NZ_CP061527.1	Shigella dysenteriae
28	2931335	2931628	+	NZ_CP061527.1	Shigella dysenteriae
29	1459740	1460033	-	NZ_CP061527.1	Shigella dysenteriae
30	3121268	3121561	+	NZ_CP061527.1	Shigella dysenteriae
31	3131866	3132159	+	NZ_CP061527.1	Shigella dysenteriae
32	1218825	1219118	-	NZ_CP061527.1	Shigella dysenteriae
33	3695975	3696268	+	NZ_CP061527.1	Shigella dysenteriae
34	3948370	3948663	+	NZ_CP061527.1	Shigella dysenteriae
35	4023828	4024121	+	NZ_CP061527.1	Shigella dysenteriae
36	4056979	4057272	+	NZ_CP061527.1	Shigella dysenteriae
37	167732	168025	-	NZ_CP061527.1	Shigella dysenteriae
38	3993465	3993758	-	NC_004337.2	Shigella flexneri 2a str. 301
39	3830987	3831280	-	NC_004337.2	Shigella flexneri 2a str. 301
40	3815094	3815387	-	NC_004337.2	Shigella flexneri 2a str. 301
41	1009110	1009403	+	NC_004337.2	Shigella flexneri 2a str. 301
42	3281959	3282252	-	NC_004337.2	Shigella flexneri 2a str. 301
43	2963797	2964090	-	NC_004337.2	Shigella flexneri 2a str. 301
44	2770226	2770519	-	NC_004337.2	Shigella flexneri 2a str. 301
45	2691266	2691559	+	NC_004337.2	Shigella flexneri 2a str. 301
46	1806935	1807228	-	NC_004337.2	Shigella flexneri 2a str. 301
47	1695641	1695934	-	NC_004337.2	Shigella flexneri 2a str. 301
48	1610824	1611117	-	NC_004337.2	Shigella flexneri 2a str. 301
49	3178916	3179209	+	NC_004337.2	Shigella flexneri 2a str. 301
50	1417918	1418211	-	NC_004337.2	Shigella flexneri 2a str. 301
51	912061	912354	-	NC_004337.2	Shigella flexneri 2a str. 301
52	706741	707034	-	NC_004337.2	Shigella flexneri 2a str. 301
53	265924	266217	-	NC_004337.2	Shigella flexneri 2a str. 301
54	1098189	1098482	+	NC_004337.2	Shigella flexneri 2a str. 301
55	3513793	3514086	+	NC_004337.2	Shigella flexneri 2a str. 301
56	4361111	4361404	+	NC_004337.2	Shigella flexneri 2a str. 301
57	3605221	3605514	+	NC_004337.2	Shigella flexneri 2a str. 301
58	495435	495728	-	NC_004337.2	Shigella flexneri 2a str. 301
59	3915197	3915490	+	NC_004337.2	Shigella flexneri 2a str. 301
60	1619091	1619384	+	NC_004337.2	Shigella flexneri 2a str. 301
61	2359915	2360208	+	NC_004337.2	Shigella flexneri 2a str. 301
62	1586725	1587018	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
63	235494	235787	+	NZ_CP045846.1	Kluyvera intermedia

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP061527.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01527.22	1.0	4	31.0	same-strand	Transposase
2	PF13384.8	1.0	4	31	same-strand	Homeodomain-like domain
3	PF13518.8	1.0	4	31.0	same-strand	Helix-turn-helix domain
4	PF00665.28	1.0	4	-293.0	same-strand	Integrase core domain
5	PF13683.8	1.0	4	-293	same-strand	Integrase core domain
6	PF00005.29	0.75	3	3501	same-strand	ABC transporter
7	PF00196.21	0.75	3	1922.5	same-strand	Bacterial regulatory proteins, luxR family
8	PF08281.14	0.75	3	2008	same-strand	Sigma-70, region 4
9	PF01609.23	0.75	3	2187.5	both-strands	Transposase DDE domain
10	PF03797.21	0.75	3	1755	opposite-strand	Autotransporter beta-domain
11	PF00132.26	0.75	3	3399	opposite-strand	Bacterial transferase hexapeptide (six repeats)
12	PF13006.9	0.75	3	2169	opposite-strand	Insertion element 4 transposase N-terminal