Result : P19731
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phenol hydroxylase P2 protein (EC 1.14.13.7) (Phenol 2-monooxygenase P2 component) |
| NCBI Accession ID | M60276.1 |
| Organism | Pseudomonas sp. (strain CF600) |
| Left | 2076 |
| Right | 2348 |
| Strand | + |
| Nucleotide Sequence | ATGTCATCACTCGTCTACATCGCCTTCCAGGATAACGACAACGCGCGTTACGTGGTGGAAGCGATCATCCAGGACAACCCCCACGCCGTCGTCCAGCACCACCCGGCGATGATCCGTATCGAGGCCGAGAAGCGCCTGGAGATCCGCAGGGAAACCGTGGAAGAGAACCTCGGCCGCGCCTGGGACGTCCAGGAAATGCTGGTGGACGTAATCACCATCGGCGGCAACGTCGACGAGGACGATGACCGCTTCGTCCTCGAGTGGAAGAACTAG |
| Sequence | MSSLVYIAFQDNDNARYVVEAIIQDNPHAVVQHHPAMIRIEAEKRLEIRRETVEENLGRAWDVQEMLVDVITIGGNVDEDDDRFVLEWKN |
| Source of smORF | Swiss-Prot |
| Function | Catabolizes phenol, and some of its methylated derivatives. P2 is required for growth on phenol, and for in vitro phenol hydroxylase activity. |
| Pubmed ID | 2254258 9012665 |
| Domain | CDD:396810 |
| Functional Category | Others |
| Uniprot ID | P19731 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 727871 | 728140 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 2 | 2793563 | 2793832 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 3 | 713305 | 713574 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 4 | 1771484 | 1771753 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 5 | 4279271 | 4279540 | - | NZ_CP020931.1 | Marinobacter salarius |
| 6 | 2322643 | 2322912 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 7 | 2970813 | 2971082 | - | NZ_CP017715.1 | Marinobacter salinus |
| 8 | 4263762 | 4264031 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 9 | 838755 | 839024 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 10 | 3179948 | 3180217 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 11 | 3309492 | 3309764 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 12 | 1805657 | 1805926 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 13 | 1806283 | 1806552 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 14 | 2816620 | 2816889 | + | NZ_CP032134.1 | Acinetobacter chinensis |
| 15 | 3420227 | 3420445 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 16 | 1034465 | 1034737 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 17 | 2362196 | 2362465 | + | NZ_CP015839.1 | Marinobacterium aestuarii |
| 18 | 999738 | 1000010 | - | NZ_LR134313.1 | Neisseria canis |
| 19 | 632345 | 632614 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 20 | 3943042 | 3943314 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 21 | 473004 | 473273 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 22 | 300985 | 301236 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 23 | 517471 | 517737 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 24 | 2697132 | 2697398 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 25 | 2833057 | 2833323 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 26 | 1334673 | 1334939 | + | NZ_CP071766.1 | Acinetobacter towneri |
| 27 | 802045 | 802311 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 28 | 2785360 | 2785626 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 29 | 308007 | 308234 | - | NZ_CP032518.1 | Cupriavidus oxalaticus |
| 30 | 1740575 | 1740847 | + | NZ_CP026111.1 | Paraburkholderia terrae |
| 31 | 2242755 | 2242976 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 32 | 375741 | 375989 | + | NZ_CP014646.1 | Thauera humireducens |
| 33 | 6833915 | 6834133 | - | NZ_CP019038.1 | Massilia putida |
| 34 | 2442705 | 2442971 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 35 | 311312 | 311581 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 36 | 1034973 | 1035245 | + | NZ_CP062804.1 | Cupriavidus basilensis |
| 37 | 2922651 | 2922872 | + | NZ_CP027669.1 | Simplicispira suum |
| 38 | 3230552 | 3230821 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 39 | 315400 | 315672 | + | NZ_CP029396.2 | Acinetobacter defluvii |
| 40 | 1415188 | 1415406 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 41 | 2453124 | 2453405 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 42 | 3932469 | 3932690 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 43 | 2199139 | 2199411 | - | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 44 | 612516 | 612797 | + | NZ_CP039288.1 | Cupriavidus necator H16 |
| 45 | 3353384 | 3353653 | - | NC_007511.1 | Burkholderia lata |
| 46 | 1190766 | 1191038 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 47 | 1013212 | 1013484 | - | NZ_CP060036.1 | Sphingobium fuliginis |
| 48 | 260105 | 260374 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 49 | 2125152 | 2125421 | + | NZ_CP016210.1 | Azoarcus olearius |
| 50 | 2526357 | 2526626 | - | NZ_CP045236.1 | Burkholderia cepacia |
| 51 | 184208 | 184477 | + | NZ_CP013452.1 | Burkholderia cenocepacia |
| 52 | 148985 | 149302 | - | NZ_CP035710.1 | Sphaerotilus natans subsp. sulfidivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014158.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00158.28 | 0.98 | 49 | 1693 | opposite-strand | Sigma-54 interaction domain |
| 2 | PF06505.13 | 0.98 | 49 | 1693 | opposite-strand | Activator of aromatic catabolism |
| 3 | PF14532.8 | 0.98 | 49 | 1693 | opposite-strand | Sigma-54 interaction domain |
| 4 | PF02830.20 | 0.98 | 49 | 1693 | opposite-strand | V4R domain |
| 5 | PF02954.21 | 0.96 | 48 | 1693.0 | opposite-strand | Bacterial regulatory protein, Fis family |
| 6 | PF07728.16 | 0.94 | 47 | 1692 | opposite-strand | AAA domain (dynein-related subfamily) |
| 7 | PF06099.13 | 1.0 | 50 | 1047.5 | same-strand | Phenol hydroxylase subunit |
| 8 | PF02332.20 | 1.0 | 50 | 23.0 | same-strand | Methane/Phenol/Toluene Hydroxylase |
| 9 | PF04945.15 | 0.88 | 44 | 35 | same-strand | YHS domain |
| 10 | PF04663.14 | 1.0 | 50 | 1632.0 | same-strand | Phenol hydroxylase conserved region |
| 11 | PF00111.29 | 1.0 | 50 | 2041.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 12 | PF00175.23 | 1.0 | 50 | 2009.0 | same-strand | Oxidoreductase NAD-binding domain |
| 13 | PF00970.26 | 0.88 | 44 | 2009.0 | same-strand | Oxidoreductase FAD-binding domain |
| 14 | PF13510.8 | 0.72 | 36 | 2009.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
++ More..