Result : P19729

Protein Information

• Protein name: Phenol hydroxylase P0 protein (EC 1.14.13.7) (Phenol 2-monooxygenase P0 component)
• NCBI Accession ID: M60276.1
• Organism: Pseudomonas sp. (strain CF600)
• Left: 746
• Right: 1024
• Strand: +
• Nucleotide Sequence: ATGACCGTGACCAATACCCCCACACCGACTTTCGATCAGCTCACTCGTTACATCCGTGTGCGCAGCGAACCAGAAGCCAAGTTCGTCGAGTTCGATTTCGCCATTGGTCATCCGGAGCTGTTCGTCGAGTTGGTGCTGCCGCAAGACGCCTTCGTGAAGTTTTGCCAGCACAACCGCGTGGTGGCAATGGACGAAGCGATGGCCAAGGCGGTGGACGACGACATGGTCAAGTGGCGCTTCGGCGATGTCGGTCGCCGCTTGCCGAAAGACCCGGGCTGA
• Sequence: MTVTNTPTPTFDQLTRYIRVRSEPEAKFVEFDFAIGHPELFVELVLPQDAFVKFCQHNRVVAMDEAMAKAVDDDMVKWRFGDVGRRLPKDPG
• Source of smORF: Swiss-Prot
• Function: Catabolizes phenol, and some of its methylated derivatives. P0 is required for growth on phenol, but not for in vitro phenol hydroxylase activity.
• Pubmed ID: 2254258
• Domain: CDD:399237
• Functional Category: Others
• Uniprot ID: P19729
• ORF Length (Amino Acid): 92

Conservation Analysis

No. of Species: 15

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2972131	2972388	-	NZ_CP017715.1	Marinobacter salinus
2	4262453	4262713	+	NC_017506.1	Marinobacter adhaerens HP15
3	4280587	4280838	-	NZ_CP020931.1	Marinobacter salarius
4	1770209	1770436	+	NZ_CP047698.1	Pseudomonas knackmussii
5	726571	726828	+	NZ_AP014862.1	Pseudomonas furukawaii
6	711992	712258	+	NZ_CP043311.1	Pseudomonas lalkuanensis
7	2792294	2792521	+	NZ_CP014158.1	Pseudomonas citronellolis
8	840077	840334	-	NC_012560.1	Azotobacter vinelandii DJ
9	3308255	3308482	+	NZ_CP051487.1	Pseudomonas umsongensis
10	3421571	3421864	-	NZ_AP014545.1	Amphritea japonica ATCC BAA-1530
11	471719	471970	+	NZ_LT906434.1	Neisseria zoodegmatis
12	1001135	1001383	-	NZ_LR134313.1	Neisseria canis
13	2321368	2321595	+	NZ_CP022562.1	Pseudomonas monteilii
14	1035862	1036110	-	NZ_CP059565.1	Neisseria wadsworthii
15	3941739	3942011	+	NZ_CP013119.1	Alcaligenes faecalis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP017715.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00111.29	1.0	15	3316	same-strand	2Fe-2S iron-sulfur cluster binding domain
2	PF00175.23	1.0	15	3316	same-strand	Oxidoreductase NAD-binding domain
3	PF00970.26	1.0	15	3316	same-strand	Oxidoreductase FAD-binding domain
4	PF13510.8	0.67	10	3316.0	same-strand	2Fe-2S iron-sulfur cluster binding domain
5	PF04663.14	1.0	15	2946	same-strand	Phenol hydroxylase conserved region
6	PF02332.20	1.0	15	720.0	same-strand	Methane/Phenol/Toluene Hydroxylase
7	PF04945.15	0.87	13	1347	same-strand	YHS domain
8	PF02406.19	1.0	15	1048	same-strand	MmoB/DmpM family
9	PF00158.28	1.0	15	387	opposite-strand	Sigma-54 interaction domain
10	PF06505.13	1.0	15	387	opposite-strand	Activator of aromatic catabolism
11	PF14532.8	1.0	15	387	opposite-strand	Sigma-54 interaction domain
12	PF02954.21	1.0	15	387	opposite-strand	Bacterial regulatory protein, Fis family
13	PF02830.20	1.0	15	387	opposite-strand	V4R domain
14	PF07728.16	1.0	15	387	opposite-strand	AAA domain (dynein-related subfamily)
15	PF00004.31	0.87	13	387	opposite-strand	ATPase family associated with various cellular activities (AAA)