| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phenol hydroxylase P0 protein (EC 1.14.13.7) (Phenol 2-monooxygenase P0 component) |
| NCBI Accession ID | M60276.1 |
| Organism | Pseudomonas sp. (strain CF600) |
| Left | 746 |
| Right | 1024 |
| Strand | + |
| Nucleotide Sequence | ATGACCGTGACCAATACCCCCACACCGACTTTCGATCAGCTCACTCGTTACATCCGTGTGCGCAGCGAACCAGAAGCCAAGTTCGTCGAGTTCGATTTCGCCATTGGTCATCCGGAGCTGTTCGTCGAGTTGGTGCTGCCGCAAGACGCCTTCGTGAAGTTTTGCCAGCACAACCGCGTGGTGGCAATGGACGAAGCGATGGCCAAGGCGGTGGACGACGACATGGTCAAGTGGCGCTTCGGCGATGTCGGTCGCCGCTTGCCGAAAGACCCGGGCTGA |
| Sequence | MTVTNTPTPTFDQLTRYIRVRSEPEAKFVEFDFAIGHPELFVELVLPQDAFVKFCQHNRVVAMDEAMAKAVDDDMVKWRFGDVGRRLPKDPG |
| Source of smORF | Swiss-Prot |
| Function | Catabolizes phenol, and some of its methylated derivatives. P0 is required for growth on phenol, but not for in vitro phenol hydroxylase activity. |
| Pubmed ID | 2254258 |
| Domain | CDD:399237 |
| Functional Category | Others |
| Uniprot ID | P19729 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2972131 | 2972388 | - | NZ_CP017715.1 | Marinobacter salinus |
| 2 | 4262453 | 4262713 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 3 | 4280587 | 4280838 | - | NZ_CP020931.1 | Marinobacter salarius |
| 4 | 1770209 | 1770436 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 5 | 726571 | 726828 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 6 | 711992 | 712258 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 7 | 2792294 | 2792521 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 8 | 840077 | 840334 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 9 | 3308255 | 3308482 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 10 | 3421571 | 3421864 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 11 | 471719 | 471970 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 12 | 1001135 | 1001383 | - | NZ_LR134313.1 | Neisseria canis |
| 13 | 2321368 | 2321595 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 14 | 1035862 | 1036110 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 15 | 3941739 | 3942011 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00111.29 | 1.0 | 15 | 3316 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 2 | PF00175.23 | 1.0 | 15 | 3316 | same-strand | Oxidoreductase NAD-binding domain |
| 3 | PF00970.26 | 1.0 | 15 | 3316 | same-strand | Oxidoreductase FAD-binding domain |
| 4 | PF13510.8 | 0.67 | 10 | 3316.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 5 | PF04663.14 | 1.0 | 15 | 2946 | same-strand | Phenol hydroxylase conserved region |
| 6 | PF02332.20 | 1.0 | 15 | 720.0 | same-strand | Methane/Phenol/Toluene Hydroxylase |
| 7 | PF04945.15 | 0.87 | 13 | 1347 | same-strand | YHS domain |
| 8 | PF02406.19 | 1.0 | 15 | 1048 | same-strand | MmoB/DmpM family |
| 9 | PF00158.28 | 1.0 | 15 | 387 | opposite-strand | Sigma-54 interaction domain |
| 10 | PF06505.13 | 1.0 | 15 | 387 | opposite-strand | Activator of aromatic catabolism |
| 11 | PF14532.8 | 1.0 | 15 | 387 | opposite-strand | Sigma-54 interaction domain |
| 12 | PF02954.21 | 1.0 | 15 | 387 | opposite-strand | Bacterial regulatory protein, Fis family |
| 13 | PF02830.20 | 1.0 | 15 | 387 | opposite-strand | V4R domain |
| 14 | PF07728.16 | 1.0 | 15 | 387 | opposite-strand | AAA domain (dynein-related subfamily) |
| 15 | PF00004.31 | 0.87 | 13 | 387 | opposite-strand | ATPase family associated with various cellular activities (AAA) |