ProsmORF-pred
Result : P18399
Protein Information
Information Type Description
Protein name Nitrogen fixation protein FixS
NCBI Accession ID Z21854.1
Organism Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Left 12942
Right 13109
Strand +
Nucleotide Sequence ATGAACACCCTTATCTATCTCATTCCAGTCGCACTCAGTCTCGGTGGTCTGGGGCTCGTCGCATTTCTGTGGGCGCTCAAGAGCGGGCAGTACGAGGACCTCGACGGAGCGTCCTGGCGCATACTCGACGACGGCGATGGCGAGGGTGAATCAAGCCAGACTTTATAG
Sequence MNTLIYLIPVALSLGGLGLVAFLWALKSGQYEDLDGASWRILDDGDGEGESSQTL
Source of smORF Swiss-Prot
Function The four proteins FixG, FixH, FixI, and FixS may participate in a membrane-bound complex coupling the FixI cation pump with a redox process catalyzed by FixG.
Pubmed ID 2536685 11481432 11474104
Domain CDD:412814
Functional Category Others
Uniprot ID P18399
ORF Length (Amino Acid) 55
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 137
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 662290 662457 - NC_020527.1 Sinorhizobium meliloti 2011
2 2318552 2318710 - NZ_CP041238.1 Ensifer mexicanus
3 1801112 1801270 - NZ_CP015880.1 Ensifer adhaerens
4 1850791 1850949 - NZ_CP023067.1 Ensifer sojae CCBAU 05684
5 1817973 1818131 - NZ_CP034909.1 Ensifer alkalisoli
6 1444856 1445011 + NZ_CP059896.1 Ciceribacter thiooxidans
7 131507 131665 - NZ_CP013501.1 Rhizobium esperanzae
8 599257 599415 + NZ_CP048632.1 Rhizobium oryzihabitans
9 162997 163155 - NZ_CP071457.1 Rhizobium lentis
10 848527 848685 - NZ_CP020911.1 Rhizobium etli
11 170365 170523 - NZ_CP013533.1 Rhizobium phaseoli
12 1143429 1143587 - NZ_CP061003.1 Agrobacterium tumefaciens
13 175924 176082 - NZ_CP071616.1 Rhizobium bangladeshense
14 2146569 2146727 - NZ_CP006880.1 Rhizobium gallicum bv. gallicum R602sp
15 5620538 5620693 - NC_019973.1 Mesorhizobium australicum WSM2073
16 5273272 5273424 + NZ_CP015318.1 Mesorhizobium amorphae CCNWGS0123
17 4260823 4260969 + NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
18 354624 354782 - NZ_CP071606.1 Rhizobium binae
19 2158848 2159006 - NZ_CP013107.1 Sinorhizobium americanum
20 638417 638572 + NZ_CP054836.1 Oricola thermophila
21 3442160 3442333 - NZ_CP021112.1 Pseudorhodoplanes sinuspersici
22 358785 358943 - NZ_CP071615.1 Rhizobium bangladeshense
23 5241321 5241470 + NC_002678.2 Mesorhizobium japonicum MAFF 303099
24 5424217 5424372 - NC_002678.2 Mesorhizobium japonicum MAFF 303099
25 114888 115046 - NZ_CP071608.1 Rhizobium binae
26 6285609 6285764 - NZ_CP033507.1 Mesorhizobium jarvisii
27 628730 628888 - NZ_CP071678.1 Rhizobium ruizarguesonis
28 566600 566755 + NZ_CP050299.1 Mesorhizobium huakuii
29 2045372 2045530 - NZ_CP029451.1 Sinorhizobium fredii CCBAU 25509
30 2500470 2500631 - NZ_CP019044.1 Salaquimonas pukyongi
31 5961622 5961771 - NZ_CP033361.1 Mesorhizobium erdmanii
32 2923197 2923370 + NZ_CP071057.1 Marinicauda algicola
33 8312646 8312813 - NZ_CP029425.1 Bradyrhizobium ottawaense
34 817082 817246 - NC_015684.1 Afipia carboxidovorans OM5
35 1017790 1017942 - NC_015684.1 Afipia carboxidovorans OM5
36 5208007 5208156 - NZ_LT960614.1 Hartmannibacter diazotrophicus
37 2463048 2463203 - NZ_CP060052.1 Croceicoccus marinus
38 1645740 1645907 + NZ_CP022219.1 Bradyrhizobium guangxiense
39 7557181 7557318 + NC_011894.1 Methylobacterium nodulans ORS 2060
40 365335 365493 - NZ_CP013535.1 Rhizobium phaseoli
41 3181785 3181952 + NZ_CP030050.1 Bradyrhizobium arachidis
42 516499 516636 - NZ_CP029550.1 Methylobacterium durans
43 1819355 1819522 + NZ_CP029426.1 Bradyrhizobium amphicarpaeae
44 456734 456901 - NZ_CP050066.1 Bradyrhizobium symbiodeficiens
45 55345 55500 - NZ_CP015322.1 Mesorhizobium amorphae CCNWGS0123
46 1960473 1960658 - NZ_CP022889.1 Tsuneonella mangrovi
47 172517 172678 + NZ_CP032696.1 Rhizobium jaguaris
48 2984083 2984250 + NZ_CP032617.1 Bradyrhizobium diazoefficiens
49 369006 369164 - NZ_CP013502.1 Rhizobium esperanzae
50 1787495 1787644 + NC_012982.1 Hirschia baltica ATCC 49814
51 5264057 5264227 - NZ_CP030053.1 Bradyrhizobium guangzhouense
52 2875670 2875837 + NZ_CP058354.1 Bradyrhizobium japonicum
53 638920 639078 - NZ_CP034999.1 Rhizobium acidisoli
54 2032696 2032851 - NZ_LR723670.1 Pseudorhizobium flavum
55 3930222 3930368 + NZ_LR723670.1 Pseudorhizobium flavum
56 1907840 1907995 - NZ_FO082820.1 Pseudorhizobium banfieldiae
57 2286851 2287000 - NZ_CP034179.1 Caenibius tardaugens NBRC 16725
58 1386006 1386173 + NZ_AP014648.1 Methyloceanibacter caenitepidi
59 458254 458412 - NZ_CP064063.1 Brucella anthropi
60 2138937 2139092 + NZ_CP054599.1 Sulfitobacter pseudonitzschiae
61 973778 973930 + NZ_CP015963.1 Altererythrobacter ishigakiensis
62 3686351 3686500 - NZ_CP032509.1 Georhizobium profundi
63 3155579 3155752 - NZ_CP042304.1 Devosia ginsengisoli
64 2459159 2459302 + NZ_LR588407.1 Brevundimonas vancanneytii
65 476616 476795 - NZ_CP024199.1 Thalassospira marina
66 1067019 1067192 + NZ_CP053856.1 Rhizobium pusense
67 1660063 1660221 + NC_022997.1 Hyphomicrobium nitrativorans NL23
68 257839 258018 - NZ_CP041025.1 Paremcibacter congregatus
69 747699 747869 + NZ_CP046052.1 Methylocystis heyeri
70 1641596 1641745 - NZ_CP045423.1 Microvirga thermotolerans
71 1222700 1222870 + NZ_CP030126.1 Indioceanicola profundi
72 98643 98801 - NC_020908.1 Octadecabacter arcticus 238
73 890313 890462 - NZ_CP049250.1 Rhizobium rhizoryzae
74 1834150 1834299 - NZ_CP016033.1 Erythrobacter neustonensis
75 2513218 2513376 - NZ_CP060436.1 Pseudooceanicola algae
76 3700049 3700207 + NZ_CP045201.1 Pseudopuniceibacterium antarcticum
77 4101123 4101275 - NZ_CP041636.1 Ferrovibrio terrae
78 3287297 3287455 + NZ_CP049037.1 Pseudohalocynthiibacter aestuariivivens
79 255472 255633 - NZ_CP042264.1 Qingshengfaniella alkalisoli
80 2479722 2479877 + NZ_CP053921.1 Erythrobacter mangrovi
81 2852973 2853113 - NZ_CP022745.1 Sphingobium xenophagum
82 1308718 1308891 + NZ_CP021404.1 Pacificitalea manganoxidans
83 3023385 3023543 - NZ_CP010650.1 Phaeobacter inhibens
84 2008566 2008715 - NC_009511.1 Sphingomonas wittichii RW1
85 3425892 3426068 - NZ_CP034588.1 Silicimonas algicola
86 1065496 1065663 + NZ_CP013002.1 Caulobacter henricii
87 493514 493672 + NZ_CP016364.1 Phaeobacter porticola
88 4193310 4193486 + NZ_CP046908.1 Stappia indica
89 1075887 1076054 + NZ_CP049241.1 Rhizobium pseudoryzae
90 3431437 3431586 + NZ_CP051131.1 Parasphingopyxis algicola
91 518680 518838 + NC_023135.1 Leisingera methylohalidivorans DSM 14336
92 2056486 2056647 + NZ_CP027850.1 Caulobacter segnis
93 3179288 3179452 - NC_014664.1 Rhodomicrobium vannielii ATCC 17100
94 420463 420621 + NZ_CP021047.1 Phaeobacter gallaeciensis
95 611001 611153 - NZ_AP017655.1 Sphingobium cloacae
96 673314 673472 + NC_009952.1 Dinoroseobacter shibae DFL 12 = DSM 16493
97 2556368 2556526 - NZ_CP041159.1 Leisingera aquaemixtae
98 1582301 1582468 + NC_011916.1 Caulobacter vibrioides NA1000
99 5633921 5634091 - NZ_CP030051.1 Bradyrhizobium guangdongense
100 399711 399884 - NZ_CP022604.1 [Ochrobactrum] quorumnocens
101 1320742 1320897 + NZ_CP015064.1 Mesorhizobium ciceri biovar biserrulae
102 4332833 4333018 - NZ_CP042968.1 Bradyrhizobium paxllaeri
103 2584932 2585090 - NZ_CP015230.1 Epibacterium mobile F1926
104 6201609 6201770 + NC_015675.1 Mesorhizobium opportunistum WSM2075
105 6246249 6246404 - NC_015675.1 Mesorhizobium opportunistum WSM2075
106 554661 554816 - NZ_CP042345.1 Novosphingobium ginsenosidimutans
107 1941722 1941868 + NZ_CP010836.1 Sphingomonas hengshuiensis
108 336749 336901 - NZ_CP012669.1 Altererythrobacter epoxidivorans
109 1256909 1257076 - NZ_CP044543.1 Bradyrhizobium betae
110 5378941 5379108 - NC_017082.1 Bradyrhizobium cosmicum
111 92103 92261 - NZ_CP060782.1 Sphingomonas sediminicola
112 907450 907602 + NZ_CP024920.1 Qipengyuania seohaensis
113 4773715 4773876 + NC_007626.1 Magnetospirillum magneticum AMB-1
114 5156508 5156657 + NC_009937.1 Azorhizobium caulinodans ORS 571
115 79965 80117 - NC_015689.1 Afipia carboxidovorans OM5
116 2468483 2468626 + NZ_CP036532.1 Roseitalea porphyridii
117 1616274 1616432 + NC_022905.1 Brucella ceti TE10759-12
118 4725543 4725707 + NC_014217.1 Starkeya novella DSM 506
119 1151068 1151211 - NZ_CP016591.1 Tsuneonella dongtanensis
120 2512331 2512504 - NZ_CP029353.1 Azospirillum thermophilum
121 367932 368090 - NC_010103.1 Brucella canis ATCC 23365
122 367931 368089 - NC_004310.3 Brucella suis 1330
123 390322 390480 - NC_009505.1 Brucella ovis ATCC 25840
124 369614 369772 - NC_013119.1 Brucella microti CCM 4915
125 1614364 1614522 + NC_003317.1 Brucella melitensis bv. 1 str. 16M
126 386072 386230 - NC_007618.1 Brucella abortus 2308
127 195362 195520 + NZ_LT605585.1 Brucella inopinata
128 3453235 3453378 - NZ_CP061205.1 Kordiimonas pumila
129 383171 383359 - NZ_CP004388.1 Thalassospira xiamenensis M-5 = DSM 17429
130 1755462 1755620 + NZ_CP014327.1 Halocynthiibacter arcticus
131 3296447 3296608 - NZ_CP053562.1 Thioclava electrotropha
132 74663 74803 + NC_014013.1 Sphingobium japonicum UT26S
133 154942 155082 + NZ_CP060036.1 Sphingobium fuliginis
134 1967591 1967749 - NZ_CP065915.1 Pelagovum pacificum
135 3557624 3557785 - NC_015730.1 Roseobacter litoralis Och 149
136 575475 575636 + NZ_CP020083.1 Blastomonas fulva
137 1179756 1179914 + NZ_CP015421.1 Rhodovulum sulfidophilum
138 2823320 2823478 - NZ_CP032125.1 Profundibacter amoris
139 2039091 2039249 + NZ_CP039964.1 Pseudorhodobacter turbinis
140 1757465 1757620 - NC_008048.1 Sphingopyxis alaskensis RB2256
141 3396510 3396671 + NZ_CP027407.1 Roseobacter denitrificans
142 1064838 1064999 + NZ_CP023449.1 Rhizorhabdus dicambivorans
143 121213 121371 - NZ_CP024422.1 Paracoccus yeei
144 576406 576564 - NZ_CP030239.1 Paracoccus mutanolyticus
145 691774 691932 - NZ_CP010855.1 Marinovum algicola DG 898
146 3719758 3719916 - NZ_CP033219.1 Parasedimentitalea marina
147 611520 611678 - NZ_CP004372.1 Roseibacterium elongatum DSM 19469
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP059896.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00122.22 0.99 135 -3 same-strand E1-E2 ATPase
2 PF00702.28 0.99 136 -3.0 same-strand haloacid dehalogenase-like hydrolase
3 PF05751.13 0.95 130 2231 same-strand FixH
4 PF13746.8 0.88 121 2749.0 same-strand 4Fe-4S dicluster domain
5 PF11614.10 0.94 129 2720.5 same-strand IG-like fold at C-terminal of FixG, putative oxidoreductase
6 PF13183.8 0.77 106 2749 same-strand 4Fe-4S dicluster domain
7 PF13534.8 0.77 106 2749 same-strand 4Fe-4S dicluster domain
8 PF12838.9 0.77 105 2747.5 same-strand 4Fe-4S dicluster domain
9 PF13187.8 0.75 103 2747.5 same-strand 4Fe-4S dicluster domain
10 PF13442.8 0.8 110 4344 same-strand Cytochrome C oxidase, cbb3-type, subunit III
11 PF14715.8 0.8 110 4366.5 same-strand N-terminal domain of cytochrome oxidase-cbb3, FixP
12 PF00034.23 0.8 110 4365 same-strand Cytochrome c
13 PF05545.13 0.66 91 5171 same-strand Cbb3-type cytochrome oxidase component FixQ
14 PF00403.28 0.87 119 -3.0 same-strand Heavy-metal-associated domain
++ More..