Result : P18393
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Enterobactin biosynthesis protein YbdZ |
| NCBI Accession ID | J04216.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 1679 |
| Right | 1897 |
| Strand | + |
| Nucleotide Sequence | ATGGCATTCAGTAATCCCTTCGATGATCCGCAGGGAGCGTTTTACATATTGCGCAATGCGCAGGGGCAATTCAGTCTGTGGCCGCAACAATGCGTCTTACCGGCAGGCTGGGACATTGTGTGTCAGCCGCAGTCACAGGCGTCCTGCCAGCAGTGGCTGGAAGCCCACTGGCGTACTCTGACACCGACGAATTTTACCCAGTTGCAGGAGGCACAATGA |
| Sequence | MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQSQASCQQWLEAHWRTLTPTNFTQLQEAQ |
| Source of smORF | Swiss-Prot |
| Function | Involved in the biosynthesis of the siderophore enterobactin (enterochelin), which is a macrocyclic trimeric lactone of N-(2,3-dihydroxybenzoyl)-serine. Plays a role in the catalytic function of EntF. It is required for adenylation of amino acids in non-ribosomal peptide biosynthesis. {ECO:0000269|Pubmed:20845982}. |
| Pubmed ID | 2974033 1826089 9278503 16738553 20845982 |
| Domain | CDD:412825 |
| Functional Category | Others |
| Uniprot ID | P18393 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 58
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 613942 | 614160 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1559162 | 1559380 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 3115771 | 3115989 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 695599 | 695817 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 587872 | 588090 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1255483 | 1255701 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 2381244 | 2381462 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 4134509 | 4134727 | + | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 981975 | 982193 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 2031204 | 2031422 | - | NZ_CP038469.1 | Citrobacter tructae |
| 11 | 645250 | 645468 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 2831035 | 2831253 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 3568939 | 3569151 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 14 | 654940 | 655158 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 15 | 4282358 | 4282576 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 16 | 2293099 | 2293311 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 1256371 | 1256583 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 18 | 3744743 | 3744955 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 3134648 | 3134866 | + | NZ_CP053416.1 | Salmonella bongori |
| 20 | 1179477 | 1179689 | + | NC_015968.1 | Enterobacter soli |
| 21 | 1307948 | 1308166 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 22 | 420107 | 420319 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 23 | 1330425 | 1330637 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 24 | 3115019 | 3115222 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 25 | 1238433 | 1238645 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 26 | 3904218 | 3904436 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 27 | 1232325 | 1232537 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 28 | 1188909 | 1189121 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 29 | 1764087 | 1764290 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 30 | 3390721 | 3390936 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 31 | 1699218 | 1699436 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 32 | 1426994 | 1427206 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 33 | 3802356 | 3802559 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 34 | 1295901 | 1296104 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 35 | 3281096 | 3281311 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 36 | 1342184 | 1342387 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 37 | 3340328 | 3340546 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 38 | 1439188 | 1439406 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 39 | 4428455 | 4428658 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 40 | 4042396 | 4042599 | - | NZ_CP054254.1 | Klebsiella variicola |
| 41 | 4283696 | 4283899 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 42 | 1492918 | 1493121 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 43 | 3201560 | 3201778 | + | NZ_CP026047.1 | Raoultella planticola |
| 44 | 140619 | 140831 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 45 | 3339489 | 3339710 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 46 | 4017666 | 4017884 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 47 | 3785432 | 3785635 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 48 | 4355537 | 4355740 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 49 | 4153624 | 4153827 | - | NZ_CP050508.1 | Raoultella terrigena |
| 50 | 1232168 | 1232389 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 51 | 3846418 | 3846636 | - | NZ_CP041247.1 | Raoultella electrica |
| 52 | 2448077 | 2448292 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 53 | 2775946 | 2776125 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 54 | 2813682 | 2813903 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 55 | 437954 | 438169 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 56 | 2824285 | 2824500 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 57 | 1278729 | 1278950 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 58 | 2947989 | 2948201 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 59 | 30920 | 31129 | - | NZ_CP065640.1 | Serratia rubidaea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17837.3 | 0.84 | 49 | 3804.5 | opposite-strand | 4'-phosphopantetheinyl transferase N-terminal domain |
| 2 | PF01648.22 | 0.62 | 36 | 3806 | opposite-strand | 4'-phosphopantetheinyl transferase superfamily |
| 3 | PF00593.26 | 0.98 | 57 | 1483.0 | opposite-strand | TonB dependent receptor |
| 4 | PF07715.17 | 0.98 | 57 | 1483.0 | opposite-strand | TonB-dependent Receptor Plug Domain |
| 5 | PF00756.22 | 0.97 | 56 | 26 | same-strand | Putative esterase |
| 6 | PF11806.10 | 0.97 | 56 | 26 | same-strand | Domain of unknown function (DUF3327) |
| 7 | PF00668.22 | 1.0 | 58 | -3.0 | same-strand | Condensation domain |
| 8 | PF00501.30 | 1.0 | 58 | -3.0 | same-strand | AMP-binding enzyme |
| 9 | PF00975.22 | 0.98 | 57 | -3.0 | same-strand | Thioesterase domain |
| 10 | PF00550.27 | 1.0 | 58 | -3 | same-strand | Phosphopantetheine attachment site |
| 11 | PF13193.8 | 0.97 | 56 | -3.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 12 | PF00005.29 | 0.9 | 52 | 4541.0 | opposite-strand | ABC transporter |
| 13 | PF01032.20 | 0.88 | 51 | 5838 | opposite-strand | FecCD transport family |
++ More..