Result : P18324
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin-1 (Fd-1) |
| NCBI Accession ID | M32238.1 |
| Organism | Streptomyces griseolus |
| Left | 1369 |
| Right | 1578 |
| Strand | + |
| Nucleotide Sequence | ATGACCATGCGGGTGAGTGCGGATCGGACGGTCTGCGTCGGTGCCGGGCTGTGTGCGCTGACGGCGCCGGGCGTCTTCGACCAGGACGACGACGGGATCGTCACGGTGCTGACGGCCGAACCCGCCGCCGACGACGACCGGCGCACCGCGCGCGAGGCCGGCCATCTCTGTCCGTCCGGTGCGGTCCGCGTCGTCGAGGACACGGAATAG |
| Sequence | MTMRVSADRTVCVGAGLCALTAPGVFDQDDDGIVTVLTAEPAADDDRRTAREAGHLCPSGAVRVVEDTE |
| Source of smORF | Swiss-Prot |
| Function | Electron transport protein for the cytochrome P-450-SU1 system. |
| Pubmed ID | 1846297 |
| Domain | CDD:418523 |
| Functional Category | Metal-binding |
| Uniprot ID | P18324 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 103
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1870281 | 1870478 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 2 | 8400671 | 8400865 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 3 | 6644985 | 6645188 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 4 | 559220 | 559426 | - | NZ_CP070326.1 | Streptomyces noursei |
| 5 | 98409 | 98600 | + | NZ_CP070326.1 | Streptomyces noursei |
| 6 | 8133954 | 8134145 | + | NZ_CP070326.1 | Streptomyces noursei |
| 7 | 169930 | 170115 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 8 | 414714 | 414905 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 9 | 3807094 | 3807264 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 10 | 888386 | 888571 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 11 | 7668410 | 7668604 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 12 | 8784734 | 8784922 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 13 | 368630 | 368815 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 14 | 701351 | 701542 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 15 | 276995 | 277195 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 16 | 857805 | 857984 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 17 | 7534185 | 7534370 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 18 | 7440875 | 7441069 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 19 | 1455139 | 1455330 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 20 | 2913024 | 2913218 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 21 | 7854912 | 7855118 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 22 | 1133897 | 1134088 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 23 | 7359905 | 7360099 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 24 | 1505128 | 1505334 | - | NC_009380.1 | Salinispora tropica CNB-440 |
| 25 | 2158568 | 2158780 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 26 | 873644 | 873835 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 27 | 6986492 | 6986683 | - | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 28 | 4322905 | 4323099 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 29 | 239558 | 239728 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 30 | 169279 | 169473 | + | NZ_CP022310.1 | Streptomyces calvus |
| 31 | 5566422 | 5566619 | - | NZ_CP022310.1 | Streptomyces calvus |
| 32 | 4461987 | 4462160 | + | NZ_CP022310.1 | Streptomyces calvus |
| 33 | 1285446 | 1285637 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 34 | 6329339 | 6329527 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 35 | 1294372 | 1294587 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 36 | 318576 | 318770 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 37 | 6705055 | 6705249 | - | NC_020990.1 | Streptomyces albidoflavus |
| 38 | 819190 | 819381 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 39 | 4981685 | 4981876 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 40 | 2379416 | 2379616 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 41 | 7105881 | 7106075 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 42 | 3930442 | 3930633 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 43 | 4250164 | 4250358 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 44 | 725999 | 726193 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 45 | 4661587 | 4661769 | + | NZ_AP023396.1 | Nocardia wallacei |
| 46 | 3800417 | 3800611 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 47 | 2305287 | 2305484 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 48 | 8604938 | 8605144 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 49 | 2170502 | 2170672 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 50 | 7279063 | 7279257 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 51 | 2339096 | 2339305 | + | NC_017093.1 | Actinoplanes missouriensis 431 |
| 52 | 1581535 | 1581729 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 53 | 4326309 | 4326515 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 54 | 4723812 | 4724012 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 55 | 6393161 | 6393331 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 56 | 1759253 | 1759444 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 57 | 6112324 | 6112515 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 58 | 2182932 | 2183102 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 59 | 2945266 | 2945457 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 60 | 1920217 | 1920411 | + | NC_007777.1 | Frankia casuarinae |
| 61 | 167858 | 168055 | - | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 62 | 5129663 | 5129860 | - | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 63 | 7981732 | 7981932 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
| 64 | 3670346 | 3670534 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 65 | 2631898 | 2632131 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 66 | 1478669 | 1478839 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 67 | 968968 | 969138 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 68 | 7490725 | 7490937 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 69 | 7244457 | 7244651 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 70 | 1808287 | 1808457 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 71 | 1921351 | 1921545 | + | NZ_CP016353.1 | Prauserella marina |
| 72 | 4656778 | 4656972 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 73 | 382336 | 382521 | - | NZ_CP031194.1 | Streptomyces paludis |
| 74 | 7907189 | 7907389 | - | NZ_CP031194.1 | Streptomyces paludis |
| 75 | 1241288 | 1241509 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 76 | 2845169 | 2845360 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 77 | 3623206 | 3623442 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 78 | 4118882 | 4119082 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 79 | 7531265 | 7531462 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 80 | 4328222 | 4328416 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 81 | 1078264 | 1078464 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 82 | 8464857 | 8465051 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 83 | 882233 | 882433 | - | NC_016113.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 84 | 8679540 | 8679710 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 85 | 2924045 | 2924218 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 86 | 2393925 | 2394110 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 87 | 280898 | 281095 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 88 | 460331 | 460534 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 89 | 2939404 | 2939598 | - | NZ_CP030862.1 | Streptomyces globosus |
| 90 | 56583 | 56777 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 91 | 4720503 | 4720685 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 92 | 5454970 | 5455170 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 93 | 2543779 | 2543973 | - | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 94 | 6183054 | 6183227 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 95 | 1590550 | 1590741 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 96 | 4046763 | 4046948 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 97 | 5792117 | 5792326 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 98 | 7232668 | 7232880 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 99 | 4584046 | 4584243 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 100 | 10091611 | 10091817 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 101 | 1802329 | 1802538 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 102 | 7806520 | 7806729 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 103 | 5237567 | 5237737 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 104 | 277747 | 277935 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 105 | 1595188 | 1595394 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 106 | 1408720 | 1408899 | + | NC_021252.1 | Amycolatopsis keratiniphila |
| 107 | 9528610 | 9528816 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 108 | 6626320 | 6626511 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 109 | 1886795 | 1886986 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 110 | 7436197 | 7436391 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 111 | 7758150 | 7758344 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 112 | 9220084 | 9220284 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 113 | 8273665 | 8273835 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 114 | 2758605 | 2758802 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 115 | 6924416 | 6924631 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 116 | 7292963 | 7293163 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 117 | 7019891 | 7020085 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 118 | 4286548 | 4286778 | - | NZ_CP023691.1 | Streptomyces platensis |
| 119 | 7186302 | 7186496 | - | NZ_CP023691.1 | Streptomyces platensis |
| 120 | 541514 | 541717 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 121 | 4003625 | 4003819 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
| 122 | 4644441 | 4644647 | + | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 123 | 8897210 | 8897401 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 124 | 5326678 | 5326869 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 125 | 1108192 | 1108392 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 126 | 874058 | 874246 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 127 | 1652751 | 1652942 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 128 | 7217980 | 7218153 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 129 | 8662680 | 8662889 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 130 | 410774 | 410986 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 131 | 150155 | 150349 | - | NZ_CP015867.1 | Streptomyces parvulus |
| 132 | 5791803 | 5791973 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 133 | 6510698 | 6510871 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 134 | 733498 | 733704 | - | NC_016109.1 | Kitasatospora setae KM-6054 |
| 135 | 3473531 | 3473719 | + | NC_014666.1 | Frankia inefficax |
++ More..