Protein name |
Abortive infection protein |
NCBI Accession ID |
J03314.1 |
Organism |
Escherichia coli |
Left |
1306 |
Right |
1575 |
Strand |
+ |
Nucleotide Sequence |
ATGACCAAAATCAAGACAGTTACTTTTGTAAATACTTACCCGGGAGGGTCTATGAAAAACTTGTTAGACACCGAGGGAACGGTTCTATTCCCATTCCAGACTGAAATCCATTTTATTTGGACGATTTTCTCCACCGTTAAACGCCTGGTTATCGGAACCAGGGACCATATTTGCCAGAAGCAATACTGGAGCGCCTGTCTCTGTATTTTGCTTCTTATGGCCTATGTGGGTCTCTGTGCTGCGGTGGTCTGGTTTGTAGTGCCCTGCTGA |
Sequence |
MTKIKTVTFVNTYPGGSMKNLLDTEGTVLFPFQTEIHFIWTIFSTVKRLVIGTRDHICQKQYWSACLCILLLMAYVGLCAAVVWFVVPC |
Source of smORF |
Swiss-Prot |
Function |
ABI may interact with a target in the cell membrane, which could be the product of the host's cmrA gene, and cause disruption of the cellular membrane such that lysis of the infected cell and death of the infecting phage would result. |
Pubmed ID |
3072577
|
Domain |
|
Functional Category |
Others |
Uniprot ID |
P18024
|
ORF Length (Amino Acid) |
89 |