Result : P18018
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein ORF7 |
| NCBI Accession ID | M32882.1 |
| Organism | Clostridium perfringens |
| Left | 4347 |
| Right | 4514 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAATATAGATTCAATAAAGTTAAGAATATTTTCAAGCATATGTTTTGCTATTGCAGGTATATTAGGATTAGTTGATAAAAATTATTTATTAGGAGGTGCATTTATTTTAATGTTAGTTAGTAATATTATTTTAATTATTTCAGAAAAGAAAAAATTAAAATAA |
| Sequence | MKNIDSIKLRIFSSICFAIAGILGLVDKNYLLGGAFILMLVSNIILIISEKKKLK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 2901768 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P18018 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 887820 | 887984 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 2 | 4082327 | 4082491 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 3 | 1841205 | 1841369 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012395.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13630.8 | 0.67 | 2 | 230.0 | same-strand | SdpI/YfhL protein family |
| 2 | PF12650.9 | 0.67 | 2 | 31.0 | same-strand | Domain of unknown function (DUF3784) |
| 3 | PF01569.23 | 0.67 | 2 | 403.0 | same-strand | PAP2 superfamily |
| 4 | PF08984.13 | 0.67 | 2 | 2193.0 | same-strand | Domain of unknown function (DUF1858) |
++ More..