Result : P17323

Protein Information

• Protein name: Lipopeptide
• NCBI Accession ID: X51393.1
• Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
• Left: 399
• Right: 539
• Strand: +
• Nucleotide Sequence: ATGAAGCGGCTGTTCCTGTCCTTCGTCGCGCTCGCCCTCCTCGCCGGCTCCATCGCCGCCTGCGGCCAGAAAGGCCCGCTGTACCTGCCGGACGACGAAAAAGCCAAGAAAGAACACAGCAAAGACCGCTACGGTTTCTGA
• Sequence: MKRLFLSFVALALLAGSIAACGQKGPLYLPDDEKAKKEHSKDRYGF
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl26118. Profile Description: Prokaryotic lipoprotein-attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.
• Pubmed ID: 2112674 10984043
• Domain: CDD:421266
• Functional Category: Others
• Uniprot ID: P17323
• ORF Length (Amino Acid): 46

Conservation Analysis

No. of Species: 20

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	5941336	5941476	+	NC_002516.2	Pseudomonas aeruginosa PAO1
2	907091	907231	-	NZ_CP048833.1	Pseudomonas multiresinivorans
3	5869119	5869259	+	NZ_CP047698.1	Pseudomonas knackmussii
4	6707244	6707384	+	NZ_CP014158.1	Pseudomonas citronellolis
5	5880496	5880636	+	NZ_CP043311.1	Pseudomonas lalkuanensis
6	247662	247808	-	NC_004578.1	Pseudomonas syringae pv. tomato str. DC3000
7	6625841	6625999	+	NZ_LS999205.1	Pseudomonas protegens CHA0
8	3776099	3776248	-	NZ_CP009533.1	Pseudomonas rhizosphaerae
9	177042	177188	+	NZ_CP068034.2	Pseudomonas syringae
10	5699428	5699574	+	NZ_CP067022.1	Pseudomonas cannabina pv. alisalensis
11	97108	97254	+	NZ_CP042804.1	Pseudomonas amygdali pv. tabaci str. ATCC 11528
12	5974149	5974289	+	NZ_AP014862.1	Pseudomonas furukawaii
13	75704	75850	+	NZ_CP062158.2	Pseudomonas lundensis
14	207718	207864	-	NZ_CP007039.1	Pseudomonas cichorii JBC1
15	201180	201305	-	NZ_AP022642.1	Pseudomonas otitidis
16	1157268	1157408	-	NZ_CP012362.1	Oblitimonas alkaliphila
17	4158635	4158769	+	NZ_CP011835.1	Azotobacter chroococcum
18	4839594	4839728	+	NC_012560.1	Azotobacter vinelandii DJ
19	3231608	3231742	-	NZ_CP045302.1	Azotobacter salinestris
20	592668	592781	-	NC_013861.1	Legionella longbeachae NSW150

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002516.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF18918.2	0.8	16	4533.0	same-strand	Family of unknown function (DUF5669)
2	PF01295.20	0.7	14	1951.0	same-strand	Adenylate cyclase, class-I
3	PF12633.9	0.7	14	1951.0	same-strand	Adenylate cyclase NT domain
4	PF01272.21	0.75	15	945	opposite-strand	Transcription elongation factor, GreA/GreB, C-term
5	PF14760.8	0.75	15	945	opposite-strand	Rnk N-terminus
6	PF01491.18	0.95	19	239	opposite-strand	Frataxin-like domain
7	PF02784.18	0.9	18	11.5	same-strand	Pyridoxal-dependent decarboxylase, pyridoxal binding domain
8	PF00278.24	0.9	18	11.5	same-strand	Pyridoxal-dependent decarboxylase, C-terminal sheet domain
9	PF01168.22	0.9	18	11.5	same-strand	Alanine racemase, N-terminal domain
10	PF01678.21	1.0	20	1264.0	same-strand	Diaminopimelate epimerase
11	PF04340.14	0.95	19	2106	same-strand	Protein of unknown function, DUF484
12	PF00589.24	0.95	19	2843	same-strand	Phage integrase family
13	PF02899.19	0.95	19	2843	same-strand	Phage integrase, N-terminal SAM-like domain
14	PF13419.8	0.9	18	3735.0	same-strand	Haloacid dehalogenase-like hydrolase
15	PF00702.28	0.9	18	3735.0	same-strand	haloacid dehalogenase-like hydrolase