Result : P16939
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Insertion element IS600 uncharacterized 11 kDa protein (ISO-S3 11 kDa protein) |
| NCBI Accession ID | X05952.1 |
| Organism | Shigella sonnei |
| Left | 65 |
| Right | 367 |
| Strand | + |
| Nucleotide Sequence | ATGAGCAGAAAAACCCAACGTTACTCTAAAGAGTTCAAAGCCGAAGCTGTCAGAACGGTTCCTGAAAATCAACTTTCGATCAGTGAAGGCGCTTCCCGATTATCTCTTCCTGAAGGCACTTTAGGACAATGGGTTACCGCCGCCAGAAAAGGGCTCGGTACTCCTGGTTCCCGCACGGTGGCTGAACTGGAATCTGAAATTCTGCAACTGCGTAAGGCGTTAAATGAAGCTCGCCTTGAGCGAGATATATTAAAAAAAGCAACAGCGTATTTTGCACAGGAGTCGCTGAAAAATACGCGTTAA |
| Sequence | MSRKTQRYSKEFKAEAVRTVPENQLSISEGASRLSLPEGTLGQWVTAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of COG2963. Profile Description: Transposase and inactivated derivatives [Mobilome: prophages, transposons]. **The ORF matches to the profile of cl21459. Profile Description: Helix-turn-helix domains. This winged helix-turn-helix domain contains an extended C-terminal alpha helix which is responsible for dimerization of this domain. |
| Pubmed ID | 2824781 |
| Domain | CDD:225511,CDD:419669 |
| Functional Category | Others |
| Uniprot ID | P16939 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2246144 | 2246446 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 4065907 | 4066209 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 3687850 | 3688152 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 847663 | 847965 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 3247225 | 3247527 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 1522231 | 1522533 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 1873914 | 1874216 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 1976433 | 1976735 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 9 | 2272592 | 2272894 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 10 | 1868844 | 1869146 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 11 | 1852294 | 1852596 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 12 | 2940995 | 2941297 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 13 | 2357647 | 2357949 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 14 | 2098908 | 2099210 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 15 | 2492992 | 2493294 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 16 | 3916669 | 3916971 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 17 | 3713043 | 3713345 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 18 | 1386716 | 1387018 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 19 | 1444425 | 1444727 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 20 | 2937437 | 2937739 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 21 | 2730440 | 2730742 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 22 | 2594063 | 2594365 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 23 | 1979058 | 1979360 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 24 | 1928137 | 1928439 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 25 | 3057271 | 3057573 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 26 | 646093 | 646395 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 27 | 4165442 | 4165744 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 28 | 3661995 | 3662297 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 29 | 895538 | 895840 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 30 | 971013 | 971315 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 31 | 1049254 | 1049556 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 32 | 3054207 | 3054509 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 33 | 2556971 | 2557273 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 34 | 1855082 | 1855384 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 35 | 1996006 | 1996308 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 36 | 2377865 | 2378167 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 37 | 2063893 | 2064195 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 38 | 2325336 | 2325638 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 39 | 2071235 | 2071537 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 40 | 2295284 | 2295586 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 41 | 1791480 | 1791782 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 42 | 2932264 | 2932566 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 43 | 3336444 | 3336746 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 44 | 872629 | 872931 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 45 | 3778335 | 3778637 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 46 | 40550 | 40852 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 47 | 3092952 | 3093254 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 48 | 2599725 | 2600027 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 49 | 2547720 | 2548022 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 50 | 2896676 | 2896978 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 51 | 849278 | 849580 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 52 | 2831343 | 2831645 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 53 | 2602328 | 2602630 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 54 | 1039830 | 1040117 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 55 | 1607085 | 1607372 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 56 | 997538 | 997801 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 57 | 1506340 | 1506633 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 58 | 2080280 | 2080543 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 59 | 207182 | 207484 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 60 | 89207 | 89509 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 61 | 137018 | 137320 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 62 | 97087 | 97389 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 63 | 44413 | 44715 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 64 | 197582 | 197884 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 65 | 4533343 | 4533645 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 66 | 699247 | 699549 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 67 | 723378 | 723680 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 68 | 825906 | 826208 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 69 | 903787 | 904089 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 70 | 914660 | 914962 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 71 | 1100914 | 1101216 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 72 | 1401173 | 1401475 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 73 | 1466391 | 1466693 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 74 | 1842573 | 1842875 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 75 | 1882952 | 1883254 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 76 | 2083934 | 2084236 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 77 | 1829184 | 1829486 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 78 | 2831741 | 2832043 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 79 | 932047 | 932349 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 80 | 713804 | 714106 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 81 | 312636 | 312938 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 82 | 264306 | 264608 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 83 | 316047 | 316349 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 84 | 1305687 | 1305989 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 85 | 2203792 | 2204094 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 86 | 2058095 | 2058397 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 87 | 2616053 | 2616355 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 88 | 2694367 | 2694669 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 89 | 1583406 | 1583708 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 90 | 1391199 | 1391501 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 91 | 917683 | 917985 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 92 | 3857369 | 3857671 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 93 | 3911469 | 3911771 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 94 | 1080780 | 1081082 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 95 | 1474805 | 1475107 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 96 | 326428 | 326730 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 97 | 3353519 | 3353821 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 98 | 1938624 | 1938926 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 99 | 2070931 | 2071233 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 100 | 331258 | 331602 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 101 | 1917369 | 1917623 | - | NZ_AP022188.1 | Aeromonas media |
| 102 | 63846 | 64154 | + | NC_010815.1 | Geobacter lovleyi SZ |
| 103 | 3101333 | 3101641 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 104 | 2743553 | 2743864 | + | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00665.28 | 0.8 | 4 | 36 | same-strand | Integrase core domain |
| 2 | PF13683.8 | 1.0 | 5 | 36 | same-strand | Integrase core domain |
| 3 | PF13333.8 | 1.0 | 5 | 36 | same-strand | Integrase core domain |
| 4 | PF13276.8 | 1.0 | 5 | 36 | same-strand | HTH-like domain |
| 5 | PF01527.22 | 0.6 | 3 | 1352.0 | both-strands | Transposase |
| 6 | PF00072.26 | 0.6 | 3 | 1371 | opposite-strand | Response regulator receiver domain |
| 7 | PF00672.27 | 0.6 | 3 | 1709 | same-strand | HAMP domain |
| 8 | PF03466.22 | 0.6 | 3 | 2220.0 | opposite-strand | LysR substrate binding domain |
| 9 | PF00126.29 | 0.6 | 3 | 952.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 10 | PF01381.24 | 0.6 | 3 | 1607 | opposite-strand | Helix-turn-helix |
| 11 | PF00106.27 | 0.6 | 3 | 1197 | opposite-strand | short chain dehydrogenase |
| 12 | PF00015.23 | 0.6 | 3 | 1671.0 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
| 13 | PF05717.15 | 0.6 | 3 | 1209 | opposite-strand | IS66 Orf2 like protein |
++ More..