Result : P16569
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core (LC 7.8) |
| NCBI Accession ID | M20806.1 |
| Organism | Microchaete diplosiphon (Fremyella diplosiphon) |
| Left | 5659 |
| Right | 5865 |
| Strand | + |
| Nucleotide Sequence | ATGGCCCGGTTGTTTAAAGTTACTGCTTGTGTACCCAGTCAAACCCGGATTCGCACCCAGCGCGAACTACAAAATACCTACTTCACCAAATTAGTACCCTTCGAGAACTGGTTCCGCGAACAGCAACGCATCATGAAAATGGGTGGCAAAATCGTTAAAGTTGAATTGGCAACTGGTAAGCAAGGTACTAACACTGGGTTGCTGTAA |
| Sequence | MARLFKVTACVPSQTRIRTQRELQNTYFTKLVPFENWFREQQRIMKMGGKIVKVELATGKQGTNTGLL |
| Source of smORF | Swiss-Prot |
| Function | Rod linker protein, associated with allophycocyanin. Linker polypeptides determine the state of aggregation and the location of the disk-shaped phycobiliprotein units within the phycobilisome and modulate their spectroscopic properties in order to mediate a directed and optimal energy transfer. |
| Pubmed ID | 2461358 |
| Domain | CDD:413625 |
| Functional Category | Others |
| Uniprot ID | P16569 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2197731 | 2197928 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 2 | 1443376 | 1443573 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 3 | 2534727 | 2534933 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 4 | 4847560 | 4847736 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 5 | 3906748 | 3906954 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 6 | 2919389 | 2919586 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 7 | 6005793 | 6005990 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 8 | 879264 | 879461 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 9 | 3816174 | 3816362 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 10 | 3110824 | 3111021 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 11 | 5995159 | 5995365 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 12 | 1998699 | 1998905 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 13 | 3522550 | 3522756 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 14 | 4876866 | 4877063 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 15 | 755999 | 756196 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 16 | 1949880 | 1950077 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 17 | 3896220 | 3896426 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 18 | 2338087 | 2338284 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 19 | 3486236 | 3486433 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 20 | 1030239 | 1030415 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 21 | 1844544 | 1844741 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 22 | 975346 | 975522 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 23 | 979541 | 979717 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 24 | 3622252 | 3622458 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 25 | 4685416 | 4685613 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 26 | 4558851 | 4559057 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 27 | 1362603 | 1362806 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 28 | 1327259 | 1327468 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 29 | 2998474 | 2998674 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019753.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00502.21 | 1.0 | 29 | 580.0 | same-strand | Phycobilisome protein |
| 2 | PF00427.23 | 0.66 | 19 | 1692 | same-strand | Phycobilisome Linker polypeptide |
++ More..