Result : P16420
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 9.3 kDa protein in soluble hydrogenase 5'region |
| NCBI Accession ID | X17482.1 |
| Organism | Anabaena cylindrica |
| Left | 2379 |
| Right | 2627 |
| Strand | + |
| Nucleotide Sequence | ATGGAGCAACTTCCTTTACCTGCACCTATCCATTACGAACTTATACTTCAACTTTTAGAAAAGCAAACCATGAATGCAGTAAGTCAGAACTCAGATTTACAGCATCAAGTCAGTCAGCTAATTGTTACCCTGCGGAAAGCTGCGTCACAACAAAAGCGACTAGAAGAAAATTGTCAAGCTTCTGCTGTTACTGTTGACCACCGTTGGTCACTTAATCATCATGGCGGAAAAGTCATCACTCCCGATTAA |
| Sequence | MEQLPLPAPIHYELILQLLEKQTMNAVSQNSDLQHQVSQLIVTLRKAASQQKRLEENCQASAVTVDHRWSLNHHGGKVITPD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17275. Profile Description: Family of unknown function (DUF5340). This family of unknown function can be found in Cyanobacteria. |
| Pubmed ID | 2129525 |
| Domain | CDD:407388 |
| Functional Category | Others |
| Uniprot ID | P16420 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4082994 | 4083242 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 2 | 90906 | 91142 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 3 | 5241051 | 5241302 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 4 | 5207706 | 5207957 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 5 | 2077441 | 2077692 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 6 | 5580110 | 5580361 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 7 | 3665419 | 3665667 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 8 | 2307215 | 2307463 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 9 | 3195321 | 3195539 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 10 | 4002724 | 4002969 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 11 | 7356641 | 7356886 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 12 | 3426873 | 3427127 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 13 | 4388406 | 4388639 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 14 | 1128068 | 1128331 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 15 | 3884006 | 3884287 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 16 | 5018931 | 5019194 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 17 | 3204072 | 3204332 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 18 | 1285963 | 1286229 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019771.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.67 | 12 | 1230.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF02852.24 | 0.67 | 12 | 1230.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 3 | PF00218.23 | 1.0 | 18 | 214.0 | same-strand | Indole-3-glycerol phosphate synthase |
++ More..