Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 9.3 kDa protein in soluble hydrogenase 5'region |
NCBI Accession ID | X17482.1 |
Organism | Anabaena cylindrica |
Left | 2379 |
Right | 2627 |
Strand | + |
Nucleotide Sequence | ATGGAGCAACTTCCTTTACCTGCACCTATCCATTACGAACTTATACTTCAACTTTTAGAAAAGCAAACCATGAATGCAGTAAGTCAGAACTCAGATTTACAGCATCAAGTCAGTCAGCTAATTGTTACCCTGCGGAAAGCTGCGTCACAACAAAAGCGACTAGAAGAAAATTGTCAAGCTTCTGCTGTTACTGTTGACCACCGTTGGTCACTTAATCATCATGGCGGAAAAGTCATCACTCCCGATTAA |
Sequence | MEQLPLPAPIHYELILQLLEKQTMNAVSQNSDLQHQVSQLIVTLRKAASQQKRLEENCQASAVTVDHRWSLNHHGGKVITPD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17275. Profile Description: Family of unknown function (DUF5340). This family of unknown function can be found in Cyanobacteria. |
Pubmed ID | 2129525 |
Domain | CDD:407388 |
Functional Category | Others |
Uniprot ID | P16420 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4082994 | 4083242 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
2 | 90906 | 91142 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
3 | 5241051 | 5241302 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
4 | 5207706 | 5207957 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
5 | 2077441 | 2077692 | + | NZ_CP031941.1 | Nostoc sphaeroides |
6 | 5580110 | 5580361 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
7 | 3665419 | 3665667 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
8 | 2307215 | 2307463 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
9 | 3195321 | 3195539 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
10 | 4002724 | 4002969 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
11 | 7356641 | 7356886 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
12 | 3426873 | 3427127 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
13 | 4388406 | 4388639 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
14 | 1128068 | 1128331 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
15 | 3884006 | 3884287 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
16 | 5018931 | 5019194 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
17 | 3204072 | 3204332 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
18 | 1285963 | 1286229 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07992.16 | 0.67 | 12 | 1230.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
2 | PF02852.24 | 0.67 | 12 | 1230.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
3 | PF00218.23 | 1.0 | 18 | 214.0 | same-strand | Indole-3-glycerol phosphate synthase |