Result : P15936
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriocin UviB |
| NCBI Accession ID | M32882.1 |
| Organism | Clostridium perfringens |
| Left | 7939 |
| Right | 8133 |
| Strand | + |
| Nucleotide Sequence | ATGGATAGTGAATTATTTAAGTTAATGGCAACACAAGGAGCCTTTGCAATATTATTTTCGTATTTATTGTTTTATGTTTTAAAAGAGAATAGTAAAAGAGAAGATAAGTATCAAAATATAATAGAGGAGCTTACAGAATTATTGCCAAAAATAAAAGAAGATGTAGAAGATATAAAAGAAAAACTTAATAAATAG |
| Sequence | MDSELFKLMATQGAFAILFSYLLFYVLKENSKREDKYQNIIEELTELLPKIKEDVEDIKEKLNK |
| Source of smORF | Swiss-Prot |
| Function | May have a role in bacteriocin secretion or immunity. |
| Pubmed ID | 2901768 2460717 |
| Domain | CDD:402508 |
| Functional Category | Antimicrobial |
| Uniprot ID | P15936 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3188367 | 3188561 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 2 | 1590757 | 1590960 | + | NZ_CP028842.1 | Clostridium botulinum |
| 3 | 2165837 | 2166040 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 4 | 1927035 | 1927238 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 5 | 1693926 | 1694129 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 6 | 1659259 | 1659462 | + | NZ_CP009687.1 | Clostridium aceticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071376.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01520.20 | 1.0 | 5 | 45.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
++ More..