Result : P15482
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Excisionase |
| NCBI Accession ID | X14899.1 |
| Organism | Streptomyces ambofaciens |
| Left | 159 |
| Right | 347 |
| Strand | + |
| Nucleotide Sequence | ATGACCACCGTCACTCCAGAGCTGCTGACCGTGCCGGAAGTCATGGCGCGGCTGAAGGTTGGACGCAGCAAGGTCTACGACCTCATCCGCACCCGCCGCCTTGCCTCCATCAAGATCGACGGAGCGCGTCGAGTACCCACCGACGCCGTACGCGACTTCATTCAGGACCAGTTGGGAGAGGCCATCTGA |
| Sequence | MTTVTPELLTVPEVMARLKVGRSKVYDLIRTRRLASIKIDGARRVPTDAVRDFIQDQLGEAI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02600. Profile Description: Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. This domain is a DNA-binding helix-turn-helix domain. |
| Pubmed ID | 2721504 |
| Domain | CDD:413393 |
| Functional Category | DNA-binding |
| Uniprot ID | P15482 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4329000 | 4329188 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 2 | 4849988 | 4850176 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 3 | 4113491 | 4113649 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 4 | 3955773 | 3955961 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 5 | 3831872 | 3832030 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 6 | 4778885 | 4779073 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 7 | 2552042 | 2552200 | - | NC_020990.1 | Streptomyces albidoflavus |
| 8 | 3919544 | 3919702 | - | NZ_CP027306.1 | Streptomyces atratus |
| 9 | 3518675 | 3518863 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 10 | 2196414 | 2196599 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 11 | 7295824 | 7296006 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 12 | 2380861 | 2381013 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 13 | 3950856 | 3951038 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 14 | 2369018 | 2369179 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 15 | 2187767 | 2187928 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 16 | 7304637 | 7304798 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 17 | 2859761 | 2859949 | + | NZ_CP070242.1 | Streptomyces californicus |
| 18 | 1982206 | 1982394 | + | NZ_CP070242.1 | Streptomyces californicus |
| 19 | 3840601 | 3840759 | + | NZ_CP070242.1 | Streptomyces californicus |
| 20 | 4201280 | 4201438 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 21 | 4670473 | 4670661 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 22 | 5267661 | 5267849 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 23 | 4016913 | 4017071 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 24 | 5176356 | 5176541 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 25 | 4477650 | 4477838 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 26 | 3292090 | 3292248 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 27 | 6814126 | 6814314 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 28 | 8258065 | 8258244 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 29 | 109160 | 109357 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 30 | 6143362 | 6143550 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 31 | 4191336 | 4191533 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 32 | 3403947 | 3404105 | - | NZ_CP022310.1 | Streptomyces calvus |
| 33 | 3867551 | 3867709 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 34 | 5057110 | 5057262 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 35 | 2778914 | 2779102 | + | NZ_CP023691.1 | Streptomyces platensis |
| 36 | 3799728 | 3799886 | - | NZ_CP023691.1 | Streptomyces platensis |
| 37 | 4310050 | 4310232 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 38 | 7723018 | 7723170 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 39 | 5707829 | 5708017 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 40 | 868896 | 869048 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 41 | 6687125 | 6687313 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 42 | 7180515 | 7180667 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 43 | 4591725 | 4591925 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 44 | 5644595 | 5644753 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 45 | 121534 | 121686 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 46 | 9147686 | 9147838 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 47 | 4355428 | 4355586 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 48 | 4204442 | 4204639 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 49 | 1342285 | 1342443 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 50 | 3853316 | 3853474 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 51 | 5337518 | 5337670 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 52 | 3673594 | 3673779 | + | NZ_CP029043.1 | Streptomyces nigra |
| 53 | 4561047 | 4561244 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 54 | 4263003 | 4263200 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 55 | 3471546 | 3471704 | + | NZ_CP070326.1 | Streptomyces noursei |
| 56 | 525622 | 525801 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 57 | 403398 | 403556 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 58 | 5661096 | 5661257 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 59 | 5488235 | 5488417 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 60 | 3419082 | 3419279 | + | NZ_CP054938.1 | Streptomyces harbinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP023440.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 44 | 0 | same-strand | Phage integrase family |
| 2 | PF14659.8 | 0.95 | 42 | 0.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
++ More..