ProsmORF-pred
Result : P15033
Protein Information
Information Type Description
Protein name Protein RacC
NCBI Accession ID M24905.1
Organism Escherichia coli (strain K12)
Left 116
Right 391
Strand +
Nucleotide Sequence ATGATTACCAATTATGAAGCCACTGTTGTAACTACCGATGACATTGTTCACGAGGTGAATCTGGAAGGAAAGCGCATTGGCTACGTAATTAAAACAGAAAATAAAGAAACCCCATTCACTGTGGTTGATATCGATGGTCCATCAGGCAACGTAAAAACACTTGATGAAGGTGTCAAAAAAATGTGCCTGGTGCATATCGGAAAGAATCTGCCCGCAGAAAAAAAAGCCGAATTTCTGGCAACTCTAATTGCAATGAAATTAAAAGGTGAAATCTGA
Sequence MITNYEATVVTTDDIVHEVNLEGKRIGYVIKTENKETPFTVVDIDGPSGNVKTLDEGVKKMCLVHIGKNLPAEKKAEFLATLIAMKLKGEI
Source of smORF Swiss-Prot
Function The ORF matches to the profile of PRK09790. Profile Description: hypothetical protein; Reviewed
Pubmed ID 2649487 9097039 9278503 16738553
Domain CDD:182076
Functional Category Others
Uniprot ID P15033
ORF Length (Amino Acid) 91
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 3
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2340273 2340548 + NZ_LR134340.1 Escherichia marmotae
2 1417488 1417763 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 1927096 1927371 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 1416561 1416836 - NC_004337.2 Shigella flexneri 2a str. 301
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LR134340.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF07151.14 0.67 2 1393 same-strand Protein of unknown function (DUF1391)
2 PF14163.8 0.67 2 785 opposite-strand Super-infection exclusion protein B
3 PF06630.13 0.67 2 102 same-strand Enterobacterial exodeoxyribonuclease VIII
4 PF12684.9 0.67 2 102 same-strand PDDEXK-like domain of unknown function (DUF3799)
5 PF03837.16 0.67 2 2695 same-strand RecT family
6 PF06688.13 0.67 2 3748 same-strand Protein of unknown function (DUF1187)
7 PF06806.14 0.67 2 4036 same-strand Putative excisionase (DUF1233)
8 PF12167.10 0.67 2 4253 same-strand Arm DNA-binding domain
9 PF00589.24 0.67 2 4253 same-strand Phage integrase family
10 PF14659.8 0.67 2 4253 same-strand Phage integrase, N-terminal SAM-like domain
++ More..