Result : P14775
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Methanol dehydrogenase [cytochrome c] subunit 2 (EC 1.1.2.7) (MDH small subunit beta) (MDH-associated peptide) (MEDH) |
| NCBI Accession ID | X15792.1 |
| Organism | Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (Methylobacterium extorquens) |
| Left | 109 |
| Right | 399 |
| Strand | + |
| Nucleotide Sequence | ATGAAGACCACTCTCATCGCCGCCGCCATCGTCGCCCTGTCCGGCCTCGCCGCCCCGGCGCTCGCCTATGACGGCACCAAGTGCAAGGCCGCGGGCAATTGCTGGGAGCCGAAGCCCGGCTTCCCCGAGAAGATCGCCGGCTCCAAGTACGATCCCAAGCACGATCCCAAGGAGCTGAACAAGCAGGCCGATTCCATCAAGCAGATGGAAGAGCGCAACAAGAAGCGTGTCGAGAACTTCAAGAAGACCGGCAAGTTCGAATACGACGTCGCCAAGATCTCGGCGAACTGA |
| Sequence | MKTTLIAAAIVALSGLAAPALAYDGTKCKAAGNCWEPKPGFPEKIAGSKYDPKHDPKELNKQADSIKQMEERNKKRVENFKKTGKFEYDVAKISAN |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the oxidation of primary alcohols including methanol. |
| Pubmed ID | 2504152 2842733 19440302 7656012 7735834 11502173 |
| Domain | CDD:396752 |
| Functional Category | Others |
| Uniprot ID | P14775 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4513504 | 4513794 | - | NZ_CP039546.1 | Methylorubrum populi |
| 2 | 1791113 | 1791403 | - | NZ_CP029550.1 | Methylobacterium durans |
| 3 | 186041 | 186331 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 4 | 262424 | 262717 | - | NC_011887.1 | Methylobacterium nodulans ORS 2060 |
| 5 | 3960689 | 3960979 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 6 | 4454270 | 4454560 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 7 | 4854914 | 4855204 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 8 | 856805 | 857053 | - | NZ_CP044331.1 | Methylocystis parvus |
| 9 | 1254948 | 1255259 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 10 | 1031923 | 1032213 | - | NZ_CP022112.1 | Nitrospirillum amazonense CBAmc |
| 11 | 1344061 | 1344324 | - | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 12 | 3966835 | 3967074 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 13 | 2210244 | 2210495 | - | NZ_CP046052.1 | Methylocystis heyeri |
| 14 | 4041359 | 4041643 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 15 | 4323115 | 4323411 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 16 | 4757721 | 4757999 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 17 | 1587444 | 1587707 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 18 | 1170513 | 1170770 | + | NZ_CP012402.1 | Azospirillum thiophilum |
| 19 | 1604112 | 1604345 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 20 | 448708 | 448947 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 21 | 773641 | 773877 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 22 | 2121597 | 2121863 | - | NC_017856.1 | Methylophaga frappieri |
| 23 | 525885 | 526130 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 24 | 2040231 | 2040506 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 25 | 2181535 | 2181810 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 26 | 544501 | 544776 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 27 | 2566166 | 2566453 | + | NZ_CP025086.1 | Methylovirgula ligni |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP039546.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13519.8 | 0.93 | 25 | 2941 | same-strand | von Willebrand factor type A domain |
| 2 | PF07726.13 | 1.0 | 27 | 136 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF07728.16 | 1.0 | 27 | 136 | same-strand | AAA domain (dynein-related subfamily) |
| 4 | PF20030.1 | 0.63 | 17 | 159 | same-strand | MoxR domain in the MoxR-vWA-beta-propeller ternary systems |
| 5 | PF13442.8 | 0.96 | 26 | 92.0 | same-strand | Cytochrome C oxidase, cbb3-type, subunit III |
| 6 | PF00034.23 | 0.63 | 17 | 87 | same-strand | Cytochrome c |
| 7 | PF00497.22 | 1.0 | 27 | 732 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 8 | PF01011.23 | 0.67 | 18 | 1738.0 | same-strand | PQQ enzyme repeat |
++ More..