Result : P14311
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 8.8 kDa protein in fixW 5'region |
| NCBI Accession ID | X16521.1 |
| Organism | Rhizobium leguminosarum |
| Left | 325 |
| Right | 564 |
| Strand | + |
| Nucleotide Sequence | ATGGCCTCGTGCTGCATCTGCATTAGACCTCGGCATCTTCCCGTCACGACGGTGACTATCGTCACGCTCTCAGAAGAAAGAATTCGCAATGTCACGCACCCGCAGAAGCCATTTCAGAAGACGAGATCACCAGCGTTTGTTGTCCAACCGATGGAACGAGCGCCGCTCTTCGAAATCGGAGCAACTCGAGCTGATACTTGGCCGGAAGGGCTCATTCCTCGAGCACGAAGCGGCCCATAA |
| Sequence | MASCCICIRPRHLPVTTVTIVTLSEERIRNVTHPQKPFQKTRSPAFVVQPMERAPLFEIGATRADTWPEGLIPRARSGP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 2555670 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P14311 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 318015 | 318254 | - | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 2 | 108394 | 108633 | - | NZ_CP071610.1 | Rhizobium binae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071682.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01012.23 | 1.0 | 2 | 743 | same-strand | Electron transfer flavoprotein domain |
| 2 | PF00578.23 | 1.0 | 2 | 21.0 | same-strand | AhpC/TSA family |
| 3 | PF00208.23 | 1.0 | 2 | 1178.5 | opposite-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
| 4 | PF02812.20 | 1.0 | 2 | 1178.5 | opposite-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
++ More..