Result : A5A611
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmgI |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1222990 |
| Right | 1223163 |
| Strand | - |
| Nucleotide Sequence | ATGAGTTATTCCTCATTTAAGATTATTCTCATTCACGTAAAAAACATAATTCCTATCATCACAGCCACGCTCATTTTGAATTATCTGAATAATAGCGAGCGTTCTTTAGTTAAGCAGATCTTAATTGAAGACGAAATTATTGTGTGTGCAACTTACTTAATACCGGACATCTAA |
| Sequence | MSYSSFKIILIHVKNIIPIITATLILNYLNNSERSLVKQILIEDEIIVCATYLIPDI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A5A611 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1204105 | 1204278 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1222990 | 1223163 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03797.21 | 1.0 | 2 | 755.0 | opposite-strand | Autotransporter beta-domain |
| 2 | PF18883.2 | 1.0 | 2 | 1305.5 | opposite-strand | Autochaperone Domain Type 1 |
| 3 | PF16456.7 | 1.0 | 2 | 356.0 | same-strand | YmgD protein |
| 4 | PF13441.8 | 1.0 | 2 | 62.0 | same-strand | YMGG-like Gly-zipper |
| 5 | PF13488.8 | 1.0 | 2 | 62.0 | same-strand | Glycine zipper |
| 6 | PF03776.16 | 1.0 | 2 | 1116.5 | same-strand | Septum formation topological specificity factor MinE |
| 7 | PF13614.8 | 1.0 | 2 | 1386.5 | same-strand | AAA domain |
| 8 | PF01656.25 | 1.0 | 2 | 1386.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 9 | PF05209.15 | 1.0 | 2 | 2222.5 | same-strand | Septum formation inhibitor MinC, N-terminal domain |
| 10 | PF03775.18 | 1.0 | 2 | 2222.5 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 11 | PF05666.13 | 1.0 | 2 | 3437.5 | opposite-strand | Fels-1 Prophage Protein-like |
++ More..