Result : P13965
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein KleB (KcrA2 protein) |
| NCBI Accession ID | X07248.1 |
| Organism | Escherichia coli |
| Left | 428 |
| Right | 643 |
| Strand | + |
| Nucleotide Sequence | ATGCCCAACCGCAAGATCGAGATTGTCACCACCAATTGCCGCCGCTGCGGTAAGTCCATTTCGACCCTTAGCCGCAGCCTGATCGGGGCGGACGCCCTGCGCGAAGAGCTGGGCGGTATCTGCGGCGATTGCATTACGCCGGAGGAACGACAGCGGATCGAGCAAGGCACCTTGCTGGCCGCGCTGCGGCAGTGCGCTGCCGCCGGGACAAGCTGA |
| Sequence | MPNRKIEIVTTNCRRCGKSISTLSRSLIGADALREELGGICGDCITPEERQRIEQGTLLAALRQCAAAGTS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10892. Profile Description: Protein of unknown function (DUF2688). Members in this family of proteins are annotated as KleB however currently no function is known. |
| Pubmed ID | 2838814 8349548 |
| Domain | CDD:371287 |
| Functional Category | DNA-binding |
| Uniprot ID | P13965 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 28893 | 29108 | + | NZ_CP019238.1 | Rhodoferax koreense |
| 2 | 51336 | 51524 | - | NZ_CP028340.1 | Thauera aromatica K172 |
| 3 | 677721 | 677936 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019238.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03230.15 | 0.67 | 2 | 1894.5 | same-strand | Antirestriction protein |
| 2 | PF17383.4 | 0.67 | 2 | 75.0 | same-strand | Uncharacterized KorC regulated protein A |
| 3 | PF17394.4 | 0.67 | 2 | 130.5 | same-strand | Uncharacterized KleE stable inheritance protein |
| 4 | PF16509.7 | 0.67 | 2 | 982.0 | same-strand | TrfB plasmid transcriptional repressor |
| 5 | PF13614.8 | 0.67 | 2 | 1290.0 | same-strand | AAA domain |
| 6 | PF01656.25 | 0.67 | 2 | 1290.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 7 | PF06613.13 | 0.67 | 2 | 2051.0 | same-strand | KorB C-terminal beta-barrel domain |
| 8 | PF02195.20 | 0.67 | 2 | 2051.0 | same-strand | ParB-like nuclease domain |
| 9 | PF08535.12 | 0.67 | 2 | 2051.0 | same-strand | KorB domain |
++ More..