Protein Information |
Information Type | Description |
---|---|
Protein name | Protein CopG (Protein RepA) |
NCBI Accession ID | M29725.1 |
Organism | Streptococcus agalactiae |
Left | 655 |
Right | 792 |
Strand | + |
Nucleotide Sequence | ATGAAAAAAAGATTGACGATAACATTAAGTGAATCGGTACTTGAAAATCTTGAAAAAATGGCAAGAGAGATGGGGTTATCAAAATCTGCAATGATTTCTGTTGCCTTGGAAAATTACAAGAAAGGTCAAGAAAAATAA |
Sequence | MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQEK |
Source of smORF | Swiss-Prot |
Function | Regulates the plasmid copy number. Binds to the RepAB promoter thus controlling the synthesis of the plasmid replication initiator protein RepB. {ECO:0000269|Pubmed:2373704, ECO:0000269|Pubmed:2497439}. |
Pubmed ID | 2438417 2677995 2497439 2373704 9857196 |
Domain | CDD:419885 |
Functional Category | DNA-binding |
Uniprot ID | P13920 |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1611 | 1766 | + | NC_014135.1 | Leuconostoc kimchii IMSNU 11154 |
2 | 1633 | 1788 | + | NC_016635.1 | Pediococcus claussenii ATCC BAA-344 |
3 | 7553 | 7666 | - | NZ_CP015445.1 | Lactobacillus helveticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01719.19 | 0.67 | 2 | 484.0 | same-strand | Plasmid replication protein |