Result : P13920
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein CopG (Protein RepA) |
| NCBI Accession ID | M29725.1 |
| Organism | Streptococcus agalactiae |
| Left | 655 |
| Right | 792 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAAGATTGACGATAACATTAAGTGAATCGGTACTTGAAAATCTTGAAAAAATGGCAAGAGAGATGGGGTTATCAAAATCTGCAATGATTTCTGTTGCCTTGGAAAATTACAAGAAAGGTCAAGAAAAATAA |
| Sequence | MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQEK |
| Source of smORF | Swiss-Prot |
| Function | Regulates the plasmid copy number. Binds to the RepAB promoter thus controlling the synthesis of the plasmid replication initiator protein RepB. {ECO:0000269|Pubmed:2373704, ECO:0000269|Pubmed:2497439}. |
| Pubmed ID | 2438417 2677995 2497439 2373704 9857196 |
| Domain | CDD:419885 |
| Functional Category | DNA-binding |
| Uniprot ID | P13920 |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1611 | 1766 | + | NC_014135.1 | Leuconostoc kimchii IMSNU 11154 |
| 2 | 1633 | 1788 | + | NC_016635.1 | Pediococcus claussenii ATCC BAA-344 |
| 3 | 7553 | 7666 | - | NZ_CP015445.1 | Lactobacillus helveticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014135.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01719.19 | 0.67 | 2 | 484.0 | same-strand | Plasmid replication protein |
++ More..