Result : P13068
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lantibiotic nisin-A |
| NCBI Accession ID | J04057.1 |
| Organism | Lactococcus lactis subsp. lactis (Streptococcus lactis) |
| Left | 298 |
| Right | 471 |
| Strand | + |
| Nucleotide Sequence | ATGAGTACAAAAGATTTTAACTTGGATTTGGTATCTGTTTCGAAGAAAGATTCAGGTGCATCACCACGCATTACAAGTATTTCGCTATGTACACCCGGTTGTAAAACAGGAGCTCTGATGGGTTGTAACATGAAAACAGCAACTTGTCATTGTAGTATTCACGTAAGCAAATAA |
| Sequence | MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCHCSIHVSK |
| Source of smORF | Swiss-Prot |
| Function | Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. |
| Pubmed ID | 3141403 1905517 2493449 1482192 7689965 5131162 1765078 1575686 8454055 8418850 |
| Domain | CDD:413688 |
| Functional Category | Antimicrobial |
| Uniprot ID | P13068 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 692007 | 692174 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 2 | 3328227 | 3328373 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3250896 | 3251042 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 3274249 | 3274395 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 4 | 1396.5 | same-strand | ABC transporter |
| 2 | PF04738.15 | 1.0 | 4 | 3231.5 | same-strand | Lantibiotic dehydratase, N terminus |
| 3 | PF02463.21 | 0.75 | 3 | 1397 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF05147.15 | 1.0 | 4 | 98.5 | same-strand | Lanthionine synthetase C-like protein |
| 5 | PF18218.3 | 1.0 | 4 | 586.5 | same-strand | Lantibiotic immunity protein Spa1 C-terminal domain |
| 6 | PF00072.26 | 0.75 | 3 | 3355 | same-strand | Response regulator receiver domain |
| 7 | PF00486.30 | 0.75 | 3 | 3355 | same-strand | Transcriptional regulatory protein, C terminal |
| 8 | PF12730.9 | 0.75 | 3 | 2133.0 | same-strand | ABC-2 family transporter protein |
| 9 | PF00664.25 | 0.75 | 3 | 1397 | same-strand | ABC transporter transmembrane region |
| 10 | PF14028.8 | 0.75 | 3 | 3232 | same-strand | Lantibiotic biosynthesis dehydratase C-term |
| 11 | PF00528.24 | 0.75 | 3 | 6543 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 12 | PF04069.14 | 0.75 | 3 | 7231 | same-strand | Substrate binding domain of ABC-type glycine betaine transport system |
++ More..