| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Relaxosome protein TraY |
| NCBI Accession ID | M14733.1 |
| Organism | Salmonella typhi |
| Left | 73 |
| Right | 282 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGGAAATATAGGGGCAAATCCAATTGGCAAGAAAGTGAATATTAGCTGTAGTCTGGATGAAGCCATTGATGAACTATTAATGGAGAGTGCACTCAAGAGTGGGTGGAGTAAAAAAAGAGAAGCTGAATTAAGACTGGAGGATCATTTACGAAGATTTTCTCTCGTACCTGCTGAAGAACAGTATATTGAAAAAAAAGTGGATTAA |
| Sequence | MSGNIGANPIGKKVNISCSLDEAIDELLMESALKSGWSKKREAELRLEDHLRRFSLVPAEEQYIEKKVD |
| Source of smORF | Swiss-Prot |
| Function | Conjugative DNA transfer (CDT) is the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI (By similarity). {ECO:0000250}. |
| Pubmed ID | 2877970 |
| Domain | CDD:421433 |
| Functional Category | DNA-binding |
| Uniprot ID | P12059 |
| ORF Length (Amino Acid) | 69 |