Result : P12049
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 702319 |
| Right | 702573 |
| Strand | + |
| Nucleotide Sequence | ATGTATAAAGTAAAAGTTTATGTCAGCTTAAAAGAAAGTGTACTAGATCCACAAGGGAGCGCTGTCCAGCATGCCTTGCACAGTATGACTTACAACGAAGTTCAAGATGTGCGCATCGGGAAATACATGGAGCTTACCATTGAAAAATCTGACCGTGATCTTGACGTGCTAGTGAAAGAAATGTGCGAAAAACTTCTTGCGAACACAGTGATTGAAGATTATAGATATGAGGTTGAGGAGGTAGTCGCACAGTGA |
| Sequence | MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDRDLDVLVKEMCEKLLANTVIEDYRYEVEEVVAQ |
| Source of smORF | Swiss-Prot |
| Function | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL. {ECO:0000255|HAMAP-Rule:MF_01926, ECO:0000269|Pubmed:10784038, ECO:0000269|Pubmed:15301530}. |
| Pubmed ID | 3036807 9384377 10784038 15301530 15301532 |
| Domain | CDD:412569 |
| Functional Category | Others |
| Uniprot ID | P12049 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 351
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 856047 | 856301 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 681679 | 681933 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 702319 | 702573 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 3281365 | 3281619 | - | NZ_CP011937.1 | Bacillus velezensis |
| 5 | 664930 | 665184 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 6 | 643102 | 643356 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 666588 | 666842 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 700979 | 701233 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 769339 | 769593 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 753382 | 753636 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 687321 | 687575 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 12 | 1307549 | 1307803 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 13 | 958899 | 959153 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 649146 | 649400 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 904206 | 904460 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 217123 | 217377 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 17 | 28387 | 28641 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 18 | 3446995 | 3447249 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 2879629 | 2879883 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 20 | 2171330 | 2171584 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 21 | 948710 | 948964 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 2413505 | 2413759 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 23 | 228699 | 228953 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 24 | 738675 | 738929 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 25 | 3454875 | 3455129 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 26 | 671722 | 671976 | + | NZ_CP053989.1 | Niallia circulans |
| 27 | 299280 | 299534 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 28 | 313395 | 313649 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 29 | 1957149 | 1957403 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 30 | 4810071 | 4810325 | - | NZ_CP040336.1 | Bacillus luti |
| 31 | 312721 | 312975 | + | NC_011725.1 | Bacillus cereus B4264 |
| 32 | 1444871 | 1445125 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 33 | 674455 | 674709 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 34 | 3837718 | 3837972 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 35 | 278142 | 278396 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 36 | 315031 | 315285 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 37 | 2972365 | 2972619 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 38 | 304521 | 304775 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 39 | 286505 | 286759 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 40 | 2713195 | 2713449 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 41 | 2957061 | 2957315 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 42 | 1299721 | 1299975 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 43 | 3701207 | 3701461 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 44 | 3908036 | 3908290 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 45 | 3002423 | 3002677 | - | NZ_CP012024.1 | Bacillus smithii |
| 46 | 159248 | 159502 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 47 | 680481 | 680735 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 48 | 870028 | 870282 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 49 | 901700 | 901954 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 50 | 673961 | 674215 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 51 | 937191 | 937445 | + | NZ_CP016538.2 | Planococcus maritimus |
| 52 | 827758 | 828012 | - | NZ_CP013661.2 | Planococcus kocurii |
| 53 | 942084 | 942338 | + | NZ_CP019401.1 | Planococcus faecalis |
| 54 | 959618 | 959872 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 55 | 882129 | 882383 | + | NZ_CP016540.2 | Planococcus versutus |
| 56 | 1003311 | 1003565 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 57 | 995646 | 995900 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 58 | 946741 | 946995 | + | NZ_CP059540.1 | Planococcus maritimus |
| 59 | 512973 | 513227 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 60 | 686099 | 686347 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 61 | 4115730 | 4115978 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 62 | 629758 | 630006 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 63 | 239592 | 239846 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 64 | 725644 | 725898 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 65 | 1820709 | 1820963 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 66 | 352327 | 352578 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 67 | 4976911 | 4977156 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 68 | 2367123 | 2367368 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 69 | 1793167 | 1793412 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 70 | 253731 | 253982 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 71 | 1900071 | 1900316 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 72 | 1843993 | 1844238 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 73 | 1818372 | 1818617 | - | NZ_LT906444.1 | Listeria welshimeri |
| 74 | 839391 | 839639 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 75 | 883606 | 883860 | + | NZ_LS483476.1 | Lederbergia lentus |
| 76 | 994650 | 994895 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 77 | 758268 | 758513 | + | NZ_CP009288.1 | Paenibacillus durus |
| 78 | 5210832 | 5211077 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 79 | 451049 | 451303 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 80 | 1091122 | 1091370 | + | NZ_LR134483.1 | Listeria grayi |
| 81 | 3240869 | 3241099 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 82 | 793573 | 793818 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 83 | 7816607 | 7816852 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 84 | 748840 | 749085 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 85 | 1820422 | 1820676 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 86 | 569489 | 569737 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 87 | 3111516 | 3111761 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 88 | 4762331 | 4762576 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 89 | 2545522 | 2545767 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 90 | 5231809 | 5232057 | - | NZ_CP026363.1 | Brevibacillus agri |
| 91 | 1645220 | 1645426 | + | NZ_CP034437.1 | Paenibacillus albus |
| 92 | 2721571 | 2721816 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 93 | 2697128 | 2697373 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 94 | 4610438 | 4610683 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 95 | 882850 | 883095 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 96 | 2672464 | 2672670 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 97 | 839659 | 839904 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 98 | 1032916 | 1033122 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 99 | 6316447 | 6316692 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 100 | 1516320 | 1516544 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 101 | 2297950 | 2298195 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 102 | 2636016 | 2636258 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 103 | 4490555 | 4490797 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 104 | 764736 | 764981 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 105 | 5221426 | 5221632 | + | NZ_CP033433.1 | Cohnella candidum |
| 106 | 2821150 | 2821395 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 107 | 547860 | 548111 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 108 | 1384549 | 1384794 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 109 | 5609425 | 5609673 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 110 | 679770 | 680015 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 111 | 673797 | 674051 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 112 | 546061 | 546312 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 113 | 1963693 | 1963938 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 114 | 4047148 | 4047396 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 115 | 523775 | 524026 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 116 | 2593273 | 2593530 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 117 | 3424634 | 3424840 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 118 | 4071238 | 4071489 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 119 | 6015673 | 6015894 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 120 | 2181113 | 2181373 | - | NZ_CP014164.1 | Aerococcus viridans |
| 121 | 5755013 | 5755219 | - | NZ_AP019400.1 | Cohnella abietis |
| 122 | 702011 | 702256 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 123 | 2711267 | 2711518 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 124 | 2313173 | 2313388 | + | NZ_LT828648.1 | Nitrospira japonica |
| 125 | 8180089 | 8180334 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 126 | 3242871 | 3243116 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 127 | 5050337 | 5050585 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 128 | 3627065 | 3627271 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 129 | 870354 | 870605 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 130 | 1038897 | 1039145 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 131 | 3572235 | 3572480 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 132 | 605536 | 605781 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 133 | 299193 | 299447 | + | NZ_CP034118.1 | Staphylospora marina |
| 134 | 582086 | 582337 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 135 | 559486 | 559731 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 136 | 2148133 | 2148408 | - | NZ_AP018933.1 | Zymobacter palmae |
| 137 | 326388 | 326645 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 138 | 1905553 | 1905801 | + | NZ_CP021434.1 | Tumebacillus avium |
| 139 | 1063952 | 1064206 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 140 | 4213291 | 4213539 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 141 | 1643678 | 1643932 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 142 | 1227773 | 1228012 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 143 | 4435921 | 4436148 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 144 | 660522 | 660770 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 145 | 616803 | 617051 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 146 | 453430 | 453681 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 147 | 807948 | 808196 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 148 | 1343075 | 1343329 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 149 | 1283285 | 1283542 | - | NZ_CP039712.1 | Vagococcus zengguangii |
| 150 | 2379867 | 2380118 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 151 | 2522901 | 2523152 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 152 | 1691106 | 1691360 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 153 | 1746323 | 1746571 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 154 | 478128 | 478376 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 155 | 3108873 | 3109079 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 156 | 958846 | 959088 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 157 | 3297718 | 3297957 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 158 | 550201 | 550452 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 159 | 1302268 | 1302516 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 160 | 991498 | 991740 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 161 | 2502832 | 2503077 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 162 | 1488561 | 1488800 | - | NZ_CP031555.1 | Thalassospira indica |
| 163 | 2193540 | 2193791 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 164 | 3595503 | 3595712 | + | NZ_CP015093.1 | Salipiger abyssi |
| 165 | 2012805 | 2013077 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 166 | 534067 | 534318 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 167 | 2100373 | 2100609 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 168 | 111397 | 111609 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 169 | 1401961 | 1402194 | - | NZ_CP031357.1 | Erythrobacter aureus |
| 170 | 2730680 | 2730922 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 171 | 1640025 | 1640240 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 172 | 3673650 | 3673862 | - | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 173 | 3434311 | 3434562 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 174 | 131394 | 131630 | + | NZ_CP053921.1 | Erythrobacter mangrovi |
| 175 | 2400388 | 2400630 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 176 | 1747127 | 1747333 | - | NZ_CP012160.1 | Octadecabacter temperatus |
| 177 | 248265 | 248519 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 178 | 343633 | 343890 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 179 | 1670241 | 1670483 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 180 | 1478662 | 1478895 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 181 | 3035325 | 3035567 | + | NZ_CP024199.1 | Thalassospira marina |
| 182 | 1761047 | 1761295 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 183 | 1838150 | 1838404 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 184 | 2166271 | 2166489 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 185 | 2260765 | 2261043 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 186 | 1420685 | 1420912 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 187 | 2282967 | 2283209 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 188 | 2442215 | 2442457 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 189 | 398282 | 398524 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 190 | 1614177 | 1614431 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 191 | 2429426 | 2429665 | - | NZ_CP022889.1 | Tsuneonella mangrovi |
| 192 | 1850247 | 1850489 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 193 | 273696 | 273938 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 194 | 1247313 | 1247555 | - | NZ_CP054836.1 | Oricola thermophila |
| 195 | 2364514 | 2364747 | - | NZ_CP024920.1 | Qipengyuania seohaensis |
| 196 | 1468230 | 1468451 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 197 | 456275 | 456523 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 198 | 35940 | 36188 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 199 | 2151846 | 2152061 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 200 | 1256643 | 1256879 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 201 | 452827 | 453057 | - | NC_009511.1 | Sphingomonas wittichii RW1 |
| 202 | 3520439 | 3520675 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 203 | 1990747 | 1991001 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 204 | 2918471 | 2918710 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 205 | 2386085 | 2386294 | - | NZ_CP033219.1 | Parasedimentitalea marina |
| 206 | 1244387 | 1244620 | - | NZ_AP019389.1 | Qipengyuania flava |
| 207 | 1732466 | 1732678 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 208 | 805626 | 805844 | - | NZ_CP060780.1 | Sphingomonas daechungensis |
| 209 | 1105807 | 1106016 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 210 | 1743273 | 1743482 | + | NZ_CP004393.1 | Celeribacter indicus |
| 211 | 1279142 | 1279351 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 212 | 2799263 | 2799523 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 213 | 1477441 | 1477680 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 214 | 1132878 | 1133096 | - | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 215 | 3347625 | 3347876 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 216 | 2021921 | 2022130 | - | NZ_CP012023.1 | Celeribacter marinus |
| 217 | 3588569 | 3588781 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 218 | 1516807 | 1517049 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 219 | 4051518 | 4051760 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 220 | 1590633 | 1590851 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 221 | 3500527 | 3500745 | - | NZ_CP034328.1 | Tabrizicola piscis |
| 222 | 2038148 | 2038375 | - | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 223 | 2338386 | 2338622 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 224 | 872059 | 872268 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 225 | 1102264 | 1102503 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 226 | 2213760 | 2213975 | + | NZ_CP060718.1 | Sphingomonas lutea |
| 227 | 1025604 | 1025843 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 228 | 981167 | 981376 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 229 | 1435408 | 1435653 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 230 | 1789660 | 1789878 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 231 | 1093268 | 1093507 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 232 | 2301800 | 2302042 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 233 | 1130366 | 1130605 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 234 | 1330402 | 1330608 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 235 | 3732242 | 3732451 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 236 | 945503 | 945733 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 237 | 2230534 | 2230746 | - | NZ_CP065915.1 | Pelagovum pacificum |
| 238 | 1296049 | 1296258 | + | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 239 | 1202052 | 1202303 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 240 | 767034 | 767273 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 241 | 1416310 | 1416555 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 242 | 2840077 | 2840310 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 243 | 1975549 | 1975767 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 244 | 1834825 | 1835043 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 245 | 1467826 | 1468056 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 246 | 1072181 | 1072414 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 247 | 156659 | 156868 | + | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 248 | 186701 | 186910 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 249 | 135097 | 135333 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 250 | 3307529 | 3307735 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 251 | 600164 | 600376 | + | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 252 | 1767424 | 1767669 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 253 | 1103176 | 1103385 | + | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 254 | 1636846 | 1637088 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 255 | 1620734 | 1620964 | + | NZ_CP060717.1 | Sphingomonas rhizophila |
| 256 | 159216 | 159458 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 257 | 1143641 | 1143880 | - | NZ_CP013002.1 | Caulobacter henricii |
| 258 | 1912671 | 1912916 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 259 | 945190 | 945423 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 260 | 1296421 | 1296660 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 261 | 673723 | 673959 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 262 | 2310911 | 2311120 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 263 | 2554532 | 2554777 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 264 | 816546 | 816788 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 265 | 818182 | 818424 | - | NC_004310.3 | Brucella suis 1330 |
| 266 | 842777 | 843019 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 267 | 822344 | 822586 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 268 | 1167215 | 1167457 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 269 | 1168346 | 1168588 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 270 | 836161 | 836403 | - | NC_007618.1 | Brucella abortus 2308 |
| 271 | 1891571 | 1891813 | + | NZ_LT605585.1 | Brucella inopinata |
| 272 | 2883241 | 2883474 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 273 | 1644993 | 1645202 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 274 | 3012672 | 3012881 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 275 | 934179 | 934403 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 276 | 2111726 | 2111932 | - | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 277 | 292382 | 292600 | + | NZ_CP039965.1 | Pseudorhodobacter turbinis |
| 278 | 3751473 | 3751709 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 279 | 1038196 | 1038411 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 280 | 1165430 | 1165642 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 281 | 943448 | 943654 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 282 | 1665872 | 1666078 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 283 | 1672134 | 1672346 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 284 | 1379781 | 1379993 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 285 | 2046585 | 2046797 | - | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 286 | 2881842 | 2882075 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 287 | 1526204 | 1526443 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 288 | 1051091 | 1051327 | + | NZ_CP053826.1 | Campylobacter curvus |
| 289 | 2074504 | 2074725 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 290 | 2468232 | 2468438 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 291 | 1193626 | 1193856 | - | NZ_CP061038.1 | Sphingomonas alpina |
| 292 | 1714955 | 1715164 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 293 | 850122 | 850328 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 294 | 1993969 | 1994214 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 295 | 749316 | 749531 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 296 | 1267833 | 1268051 | + | NZ_CP012543.1 | Campylobacter rectus |
| 297 | 1981404 | 1981622 | + | NZ_CP030918.1 | Paracoccus suum |
| 298 | 855177 | 855407 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 299 | 2472090 | 2472305 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 300 | 641508 | 641726 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 301 | 969411 | 969647 | + | NZ_CP012541.1 | Campylobacter concisus |
| 302 | 2012173 | 2012382 | + | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 303 | 2573263 | 2573475 | + | NZ_CP009571.1 | Sphingomonas taxi |
| 304 | 1869112 | 1869318 | - | NZ_AP019700.1 | Stella humosa |
| 305 | 2077450 | 2077689 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 306 | 1213957 | 1214172 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 307 | 1356578 | 1356814 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 308 | 1605357 | 1605566 | + | NZ_CP048788.1 | Roseobacter ponti |
| 309 | 242005 | 242211 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 310 | 1043473 | 1043718 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 311 | 559034 | 559255 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 312 | 1164291 | 1164512 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 313 | 385708 | 385926 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 314 | 1313823 | 1314059 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 315 | 624174 | 624425 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 316 | 840991 | 841206 | + | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 317 | 2187693 | 2187941 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 318 | 1338832 | 1339050 | + | NZ_CP032125.1 | Profundibacter amoris |
| 319 | 2141511 | 2141732 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 320 | 267509 | 267754 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 321 | 1991154 | 1991372 | - | NZ_CP012661.1 | Defluviimonas alba |
| 322 | 957903 | 958133 | + | NZ_CP059443.1 | Campylobacter fetus |
| 323 | 1762336 | 1762542 | - | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 324 | 577508 | 577753 | + | NZ_LS974202.1 | Mesotoga infera |
| 325 | 1503136 | 1503369 | - | NZ_CP047045.1 | Terricaulis silvestris |
| 326 | 282248 | 282475 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 327 | 493656 | 493898 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 328 | 400854 | 401099 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 329 | 320242 | 320469 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 330 | 318503 | 318748 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 331 | 2295674 | 2295919 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 332 | 2853820 | 2854035 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 333 | 1037858 | 1038088 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 334 | 2851045 | 2851266 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 335 | 1460101 | 1460328 | + | NZ_CP053856.1 | Rhizobium pusense |
| 336 | 1552488 | 1552715 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 337 | 150059 | 150286 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 338 | 768090 | 768320 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 339 | 675532 | 675738 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 340 | 1026476 | 1026682 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 341 | 1000375 | 1000617 | - | NZ_CP064063.1 | Brucella anthropi |
| 342 | 866399 | 866641 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 343 | 755350 | 755580 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 344 | 342092 | 342337 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 345 | 344980 | 345225 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 346 | 229302 | 229547 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 347 | 2281772 | 2282014 | - | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 348 | 2047578 | 2047829 | - | NZ_CP011311.1 | Corynebacterium camporealensis |
| 349 | 327617 | 327832 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 350 | 5491887 | 5492105 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 351 | 2167665 | 2167883 | - | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 352 | 2873760 | 2873969 | - | NZ_CP011542.1 | Corynebacterium mustelae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01259.20 | 0.91 | 318 | 32 | same-strand | SAICAR synthetase |
| 2 | PF13507.8 | 0.94 | 330 | 2 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
++ More..