Result : P11866
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Threonine dehydratase operon activator protein |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 3267380 |
| Right | 3267598 |
| Strand | + |
| Nucleotide Sequence | ATGAGCAAGTTCTCAAATTTTATTATAAATAAACCATTTTCAGTGATAAATAATGCGGCATGTCACATTTTTTCACGCTATTTGTTGGAGAACAAACATTTATTTTATCAATATTTTAAAATTTCGAATACATGTATTGATCATCTCGAACAATTGATTAACGTCAACTTTTTCTCTTCTGACAGGACGTCATTTTGTGAATGCAATCGTTTTCCATAA |
| Sequence | MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSSDRTSFCECNRFP |
| Source of smORF | Swiss-Prot |
| Function | Probable trans-acting positive activator for the tdc operon. |
| Pubmed ID | 2660107 2573820 9278503 16738553 7928991 |
| Domain | |
| Functional Category | DNA-binding |
| Uniprot ID | P11866 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3267380 | 3267598 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4007137 | 4007355 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3258886 | 3259104 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 535329 | 535547 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02901.17 | 1.0 | 3 | 4962.0 | opposite-strand | Pyruvate formate lyase-like |
| 2 | PF01228.23 | 1.0 | 3 | 4962.0 | opposite-strand | Glycine radical |
| 3 | PF00871.19 | 1.0 | 3 | 3720.0 | opposite-strand | Acetokinase family |
| 4 | PF03222.15 | 1.0 | 3 | 2363.0 | opposite-strand | Tryptophan/tyrosine permease family |
| 5 | PF00291.27 | 1.0 | 3 | 1352.0 | opposite-strand | Pyridoxal-phosphate dependent enzyme |
| 6 | PF03466.22 | 1.0 | 3 | 315.0 | opposite-strand | LysR substrate binding domain |
| 7 | PF00126.29 | 1.0 | 3 | 315.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 8 | PF02595.17 | 0.67 | 2 | 3014 | opposite-strand | Glycerate kinase family |
| 9 | PF03446.17 | 0.67 | 2 | 4256 | opposite-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
| 10 | PF14833.8 | 0.67 | 2 | 4256 | opposite-strand | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
| 11 | PF03807.19 | 0.67 | 2 | 4256 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
++ More..