Result : P11540
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Barstar (Ribonuclease inhibitor) |
| NCBI Accession ID | X15545.1 |
| Organism | Bacillus amyloliquefaciens (Bacillus velezensis) |
| Left | 124 |
| Right | 396 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAGCAGTCATTAACGGGGAACAAATCAGAAGTATCAGCGACCTCCACCAGACATTGAAAAAGGAGCTTGCCCTTCCGGAATACTACGGTGAAAACCTGGACGCTTTATGGGATTGTCTGACCGGATGGGTGGAGTACCCGCTCGTTTTGGAATGGAGGCAGTTTGAACAAAGCAAGCAGCTGACTGAAAATGGCGCCGAGAGTGTGCTTCAGGTTTTCCGTGAAGCGAAAGCGGAAGGCTGCGACATCACCATCATACTTTCTTAA |
| Sequence | MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTGWVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the ribonuclease barnase. Forms a one-to-one non-covalent complex. |
| Pubmed ID | 3050134 2696173 16100951 9757110 8405454 8043574 |
| Domain | CDD:412713 |
| Functional Category | Others |
| Uniprot ID | P11540 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 839784 | 840056 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 2 | 3105246 | 3105518 | - | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 3741553 | 3741828 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 4 | 3547580 | 3547855 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 5 | 2540162 | 2540437 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 3558337 | 3558612 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 5071849 | 5072127 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 8 | 1569984 | 1570256 | + | NZ_CP020953.1 | Clostridium drakei |
| 9 | 500353 | 500631 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 10 | 2739512 | 2739790 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 11 | 471469 | 471747 | - | NZ_CP043404.1 | Bacillus safensis |
++ More..