Protein Information |
Information Type | Description |
---|---|
Protein name | RNA-binding protein Hfq |
NCBI Accession ID | CP000679.1 |
Organism | Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) |
Left | 2188963 |
Right | 2189262 |
Strand | - |
Nucleotide Sequence | GTGGCAAAAGGAAATTTGAACTTGCAGGATTTATTTTTAAACCAGCTTCGAAAAGAAAAAGTCAACGTTACAATCTTTTTACTGAGCGGATTCCAATTGAAAGGAGTTATCAAAGGTTTTGATAACTTTACATTGGTGGTAGAGACAGAAAATAACAAACAGCAGCTCATTTACAAACATGCAATTTCTTCTATTCTACCATCAAAGCCAATAAACTACATGGCTCAAGTTCAAAACTCACAAGTGCAAAACACAGCTTCTCAGCAAAGTAACAATAACCAAAATCAAGAGTCAAAATAA |
Sequence | MAKGNLNLQDLFLNQLRKEKVNVTIFLLSGFQLKGVIKGFDNFTLVVETENNKQQLIYKHAISSILPSKPINYMAQVQNSQVQNTASQQSNNNQNQESK |
Source of smORF | Swiss-Prot |
Function | RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs. {ECO:0000255|HAMAP-Rule:MF_00436}. |
Pubmed ID | |
Domain | CDD:412267 |
Functional Category | RNA-binding |
Uniprot ID | A4XL44 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2188963 | 2189262 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
2 | 1227230 | 1227529 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
3 | 1246953 | 1247210 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
4 | 1028868 | 1029131 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
5 | 2198881 | 2199132 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
6 | 2926629 | 2926880 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
7 | 1885432 | 1885683 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
8 | 1928123 | 1928380 | - | NC_013385.1 | Ammonifex degensii KC4 |
9 | 1072152 | 1072406 | + | NZ_CP017237.1 | Moorella thermoacetica |
10 | 1409762 | 1410010 | - | NZ_CP034118.1 | Staphylospora marina |
11 | 4954741 | 4955007 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
12 | 1373713 | 1373964 | + | NZ_HG917868.1 | Clostridium bornimense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06838.13 | 0.83 | 10 | 1985.0 | same-strand | Methionine gamma-lyase |
2 | PF01715.19 | 0.92 | 11 | 38 | same-strand | IPP transferase |
3 | PF01119.21 | 0.83 | 10 | 1760.5 | same-strand | DNA mismatch repair protein, C-terminal domain |
4 | PF08676.13 | 0.83 | 10 | 1760.5 | same-strand | MutL C terminal dimerisation domain |