Protein Information |
Information Type | Description |
---|---|
Protein name | Ferredoxin-like protein in nif region |
NCBI Accession ID | J03411.1 |
Organism | Azotobacter vinelandii |
Left | 2226 |
Right | 2504 |
Strand | + |
Nucleotide Sequence | ATGGCGCTGAAAATTGTGGAATCCTGTGTCAATTGTTGGGCATGTGTCGATGTCTGTCCGAGCGAGGCGATCTCCCTGGCCGGCCCGCACTTCGAGATCAGTGCGAGCAAGTGCACCGAGTGTGACGGGGACTACGCGGAAAAGCAGTGCGCGAGCATCTGTCCGGTCGAGGGCGCCATCCTGCTCGCCGACGGCACGCCGGCAAACCCGCCTGGTTCGCTGACCGGGATTCCCCCGGAGCGTCTGGCCGAGGCCATGCGCGAAATCCAGGCCCGCTAA |
Sequence | MALKIVESCVNCWACVDVCPSEAISLAGPHFEISASKCTECDGDYAEKQCASICPVEGAILLADGTPANPPGSLTGIPPERLAEAMREIQAR |
Source of smORF | Swiss-Prot |
Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
Pubmed ID | 2450865 |
Domain | CDD:403902 |
Functional Category | Metal-binding |
Uniprot ID | P11054 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5173568 | 5173846 | + | NC_012560.1 | Azotobacter vinelandii DJ |
2 | 4404421 | 4404699 | + | NZ_CP011835.1 | Azotobacter chroococcum |
3 | 2863442 | 2863720 | - | NZ_CP045302.1 | Azotobacter salinestris |
4 | 1861501 | 1861779 | + | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
5 | 2326655 | 2326933 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
6 | 3854458 | 3854736 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
7 | 3603137 | 3603415 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
8 | 1087811 | 1088089 | + | NZ_CP072793.1 | Thiothrix unzii |
9 | 1291244 | 1291528 | - | NZ_CP014476.1 | Methylomonas denitrificans |
10 | 1943523 | 1943783 | - | NZ_AP018724.1 | Sulfurivermis fontis |
11 | 3864055 | 3864333 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
12 | 2522749 | 2523027 | + | NZ_CP060084.1 | Teredinibacter haidensis |
13 | 3560085 | 3560363 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
14 | 1004773 | 1005051 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
15 | 3424064 | 3424342 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
16 | 1778057 | 1778335 | + | NC_015572.1 | Methylomonas methanica MC09 |
17 | 63926 | 64204 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
18 | 821853 | 822107 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
19 | 1342295 | 1342573 | - | NZ_CP064781.1 | Azospira restricta |
20 | 1506026 | 1506307 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
21 | 3395946 | 3396215 | + | NZ_CP010803.1 | Martelella endophytica |
22 | 568644 | 568934 | + | NZ_CP016210.1 | Azoarcus olearius |
23 | 1661538 | 1661828 | - | NZ_CP029331.1 | Thauera hydrothermalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04055.23 | 1.0 | 23 | 42 | same-strand | Radical SAM superfamily |
2 | PF02579.19 | 1.0 | 23 | 43.5 | same-strand | Dinitrogenase iron-molybdenum cofactor |
3 | PF04891.14 | 0.87 | 20 | 763.5 | same-strand | NifQ |
4 | PF00111.29 | 0.65 | 15 | 1884 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |