Protein Information |
Information Type | Description |
---|---|
Protein name | 23S rRNA methylase leader peptide (Erythromycin resistance leader peptide) |
NCBI Accession ID | M19270.1 |
Organism | Escherichia coli |
Left | 701 |
Right | 796 |
Strand | + |
Nucleotide Sequence | ATGTTGGTATTCCAAATGCGTTATCAAATGCGTTATGTAGATAAAACATCTACTGTTTTGAAACAGACTAAAAAAAGTGATTACGCAGATAAATAA |
Sequence | MLVFQMRYQMRYVDKTSTVLKQTKKSDYADK |
Source of smORF | Swiss-Prot |
Function | This peptide is involved in the control mechanism of the synthesis of the erythromycin resistance protein. |
Pubmed ID | 2832378 |
Domain | CDD:368836 |
Functional Category | Others |
Uniprot ID | P10739 |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 751179 | 751262 | + | NZ_AP019309.1 | Intestinibaculum porci |
2 | 3494571 | 3494654 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
3 | 796581 | 796664 | + | NZ_AP022822.1 | Enterococcus saigonensis |
4 | 1099995 | 1100078 | + | NZ_LS483306.1 | Enterococcus cecorum |
5 | 1238601 | 1238684 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
6 | 239327 | 239410 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
7 | 1592677 | 1592760 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
8 | 1696800 | 1696883 | - | NZ_AP022321.1 | Veillonella nakazawae |
9 | 887383 | 887466 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
10 | 1478805 | 1478888 | + | NZ_CP046314.1 | Gemella morbillorum |
11 | 12903 | 12986 | - | NZ_AP022823.1 | Enterococcus saigonensis |
12 | 736582 | 736665 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00398.22 | 1.0 | 11 | 125.0 | same-strand | Ribosomal RNA adenine dimethylase |
2 | PF13649.8 | 0.64 | 7 | 125 | same-strand | Methyltransferase domain |
3 | PF00239.23 | 0.64 | 7 | 1217 | same-strand | Resolvase, N terminal domain |