Result : P10739
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 23S rRNA methylase leader peptide (Erythromycin resistance leader peptide) |
| NCBI Accession ID | M19270.1 |
| Organism | Escherichia coli |
| Left | 701 |
| Right | 796 |
| Strand | + |
| Nucleotide Sequence | ATGTTGGTATTCCAAATGCGTTATCAAATGCGTTATGTAGATAAAACATCTACTGTTTTGAAACAGACTAAAAAAAGTGATTACGCAGATAAATAA |
| Sequence | MLVFQMRYQMRYVDKTSTVLKQTKKSDYADK |
| Source of smORF | Swiss-Prot |
| Function | This peptide is involved in the control mechanism of the synthesis of the erythromycin resistance protein. |
| Pubmed ID | 2832378 |
| Domain | CDD:368836 |
| Functional Category | Others |
| Uniprot ID | P10739 |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 751179 | 751262 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 2 | 3494571 | 3494654 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 3 | 796581 | 796664 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 4 | 1099995 | 1100078 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 5 | 1238601 | 1238684 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 6 | 239327 | 239410 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 7 | 1592677 | 1592760 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 8 | 1696800 | 1696883 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 9 | 887383 | 887466 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 10 | 1478805 | 1478888 | + | NZ_CP046314.1 | Gemella morbillorum |
| 11 | 12903 | 12986 | - | NZ_AP022823.1 | Enterococcus saigonensis |
| 12 | 736582 | 736665 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP049740.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00398.22 | 1.0 | 11 | 125.0 | same-strand | Ribosomal RNA adenine dimethylase |
| 2 | PF13649.8 | 0.64 | 7 | 125 | same-strand | Methyltransferase domain |
| 3 | PF00239.23 | 0.64 | 7 | 1217 | same-strand | Resolvase, N terminal domain |
++ More..