Result : P10512
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Relaxosome protein TraY |
| NCBI Accession ID | X13681.1 |
| Organism | Escherichia coli |
| Left | 130 |
| Right | 357 |
| Strand | + |
| Nucleotide Sequence | GTGAGGAGGCGTAACGCGAGAGGCGGGATAAGCAGAACAGTCTCAGTGTATCTCGATGAAGATACAAATAACCGACTTATTCGGGCCAAAGATCGTAGCGGTAGAAGTAAAACTATAGAGGTTCAGATCCGTCTCAGAGATCATCTGAAACGGTTTCCTGATTTCTATAATGAAGAAATATTCAGGGAGGTGATCGAAGAGAACGAGTCAACATTTAAAGAACTTTAG |
| Sequence | MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENESTFKEL |
| Source of smORF | Swiss-Prot |
| Function | Conjugative DNA transfer (CDT) is the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI. Also positively regulates tra gene expression (By similarity). {ECO:0000250}. |
| Pubmed ID | 3009392 2564189 |
| Domain | CDD:421433 |
| Functional Category | DNA-binding |
| Uniprot ID | P10512 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 62361 | 62588 | + | NC_003277.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 50714 | 50914 | - | NZ_CP041250.1 | Raoultella electrica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003277.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01464.22 | 1.0 | 2 | 1804.5 | opposite-strand | Transglycosylase SLT domain |
| 2 | PF07178.13 | 1.0 | 2 | 1624.5 | same-strand | TraL protein |
++ More..