ProsmORF-pred
Result : P0DPP3
Protein Information
Information Type Description
Protein name Protein YecU
NCBI Accession ID U00096.3
Organism Escherichia coli (strain K12)
Left 1995655
Right 1995831
Strand +
Nucleotide Sequence ATGATAAAAATATTTATTGGTCATTATATTAACGTATTTTATAGCACTGCCGATATCACGCTCAAAAAACAACCACTGCTATTTTTAGCAAAGCTTATGGTATACTCCGCCGCCTTAACATTTTTCACCGCAAATTTTCATTGCAACATGACGAGGAAAATAAATGAGTACGCCTGA
Sequence MIKIFIGHYINVFYSTADITLKKQPLLFLAKLMVYSAALTFFTANFHCNMTRKINEYA
Source of smORF Swiss-Prot
Function
Pubmed ID 9278503 29645342
Domain
Functional Category Others
Uniprot ID P0DPP3
ORF Length (Amino Acid) 58
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 4
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1995655 1995831 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1991937 1992113 + NC_004337.2 Shigella flexneri 2a str. 301
3 2572163 2572339 + NZ_CP061527.1 Shigella dysenteriae
4 2618063 2618239 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
5 1926534 1926710 + NZ_AP014857.1 Escherichia albertii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03222.15 1.0 4 4763.0 same-strand Tryptophan/tyrosine permease family
2 PF03695.15 1.0 4 4035.5 opposite-strand Uncharacterised protein family (UPF0149)
3 PF02810.17 1.0 4 4035.5 opposite-strand SEC-C motif
4 PF01066.23 1.0 4 2838 opposite-strand CDP-alcohol phosphatidyltransferase
5 PF08459.13 1.0 4 949 opposite-strand UvrC RIbonuclease H-like domain
6 PF00633.25 1.0 4 949 opposite-strand Helix-hairpin-helix motif
7 PF01541.26 1.0 4 949 opposite-strand GIY-YIG catalytic domain
8 PF02151.21 1.0 4 949 opposite-strand UvrB/uvrC motif
9 PF14520.8 1.0 4 949 opposite-strand Helix-hairpin-helix domain
10 PF00072.26 1.0 4 296 opposite-strand Response regulator receiver domain
11 PF00196.21 1.0 4 296.0 opposite-strand Bacterial regulatory proteins, luxR family
12 PF10769.11 1.0 4 -13 same-strand Protein of unknown function (DUF2594)
13 PF03472.17 1.0 4 279 opposite-strand Autoinducer binding domain
14 PF00005.29 1.0 4 1231 opposite-strand ABC transporter
15 PF02463.21 1.0 4 1231 opposite-strand RecF/RecN/SMC N terminal domain
16 PF13401.8 1.0 4 1231 opposite-strand AAA domain
17 PF00528.24 0.75 3 1979.5 opposite-strand Binding-protein-dependent transport system inner membrane component
18 PF00291.27 0.75 3 2662 opposite-strand Pyridoxal-phosphate dependent enzyme
++ More..