Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0473 protein Csac_1599 |
NCBI Accession ID | CP000679.1 |
Organism | Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) |
Left | 1758137 |
Right | 1758439 |
Strand | + |
Nucleotide Sequence | ATGGATATGTTTGCAGACAATGTTGTAACATTAGTAGATGAGGAAGGAAGAGAGATATCATTTGAAATGCTCGATAAGGTCAATTACAATGGTAATGACTATATAGTCCTTCTTCCTTTAGAAGAGATTGAAAAGGAAGACGAAGAGGCAGAGGTCATCATACTGCGAATTGAAGATAGAGACGGAGAAGAGGTCTATGTTGGTGTAGAAGATGAGGAGGAGCTTGAAAACGTATTTGAAATCTTCCAGTCCCGCTTTGACGATGAAGACTTTGACATGTATGATGAAGAAGATGAAGAATAA |
Sequence | MDMFADNVVTLVDEEGREISFEMLDKVNYNGNDYIVLLPLEEIEKEDEEAEVIILRIEDRDGEEVYVGVEDEEELENVFEIFQSRFDDEDFDMYDEEDEE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
Pubmed ID | |
Domain | CDD:412983 |
Functional Category | Others |
Uniprot ID | A4XJV6 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1697944 | 1698246 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
2 | 1758137 | 1758439 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
3 | 1050600 | 1050899 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
4 | 1611809 | 1612108 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
5 | 1500663 | 1500962 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
6 | 619928 | 620224 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
7 | 1190393 | 1190689 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
8 | 1716130 | 1716429 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
9 | 1243628 | 1243927 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
10 | 2450617 | 2450883 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
11 | 2618033 | 2618284 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
12 | 1389781 | 1390032 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
13 | 548103 | 548369 | + | NZ_CP045875.1 | Heliorestis convoluta |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00698.23 | 0.62 | 8 | 3762.5 | same-strand | Acyl transferase domain |
2 | PF08541.12 | 0.69 | 9 | 2758 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
3 | PF08545.12 | 0.69 | 9 | 2758 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
4 | PF02504.17 | 0.69 | 9 | 1750 | same-strand | Fatty acid synthesis protein |
5 | PF00483.25 | 0.69 | 9 | 114 | same-strand | Nucleotidyl transferase |
6 | PF01370.23 | 0.69 | 9 | 482 | same-strand | NAD dependent epimerase/dehydratase family |
7 | PF16363.7 | 0.69 | 9 | 482 | same-strand | GDP-mannose 4,6 dehydratase |
8 | PF01073.21 | 0.69 | 9 | 482 | same-strand | 3-beta hydroxysteroid dehydrogenase/isomerase family |
9 | PF02719.17 | 0.69 | 9 | 482 | same-strand | Polysaccharide biosynthesis protein |