| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YoaL |
| NCBI Accession ID | |
| Organism | Escherichia coli (strain K12) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MDRHRRHFSIRPFNACLSGTLCRTFRLHFVVTPALFLASNSYSLSRSLSWNS |
| Source of smORF | Swiss-Prot |
| Function | May serve a regulatory role in expression of downstream gene yoaE; in a yoaL-yoaE-lacZ fusion mutation of the start codon to a stop codon in yoaL decreases expression of beta-galactosidase, suggesting translation of the 2 genes is coupled. {ECO:0000269|Pubmed:30837344}. |
| Pubmed ID | 9278503 29645342 30837344 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0DPP2 |
| ORF Length (Amino Acid) | 52 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1448568 | 1448726 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 2503539 | 2503697 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1901573 | 1901731 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 1817399 | 1817557 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1948385 | 1948543 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1834497 | 1834655 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4529814 | 4529972 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 8 | 553582 | 553740 | - | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 1358549 | 1358707 | - | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 244731 | 244889 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 11 | 4144983 | 4145123 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 1125453 | 1125593 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 13 | 2797672 | 2797812 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 14 | 1976153 | 1976293 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 15 | 1928045 | 1928212 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 16 | 4439043 | 4439210 | - | NZ_CP053416.1 | Salmonella bongori |
| 17 | 2009772 | 2009930 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 18 | 4500777 | 4500935 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 19 | 2878315 | 2878473 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 20 | 2790113 | 2790271 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 21 | 2844730 | 2844885 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06173.14 | 1.0 | 20 | 3064 | opposite-strand | Protein of unknown function (DUF986) |
| 2 | PF03613.16 | 1.0 | 20 | 2154 | opposite-strand | PTS system mannose/fructose/sorbose family IID component |
| 3 | PF03609.16 | 1.0 | 20 | 1341 | opposite-strand | PTS system sorbose-specific iic component |
| 4 | PF03830.17 | 1.0 | 20 | 316 | opposite-strand | PTS system sorbose subfamily IIB component |
| 5 | PF03610.18 | 1.0 | 20 | 316 | opposite-strand | PTS system fructose IIA component |
| 6 | PF03741.18 | 1.0 | 20 | -12 | same-strand | Integral membrane protein TerC family |
| 7 | PF03471.19 | 1.0 | 20 | -12 | same-strand | Transporter associated domain |
| 8 | PF00563.22 | 0.95 | 19 | 1554.0 | opposite-strand | EAL domain |
| 9 | PF12792.9 | 1.0 | 20 | 1554 | opposite-strand | CSS motif domain associated with EAL |
| 10 | PF03313.17 | 0.95 | 19 | 3284.5 | opposite-strand | Serine dehydratase alpha chain |
| 11 | PF03315.17 | 0.95 | 19 | 3284.5 | opposite-strand | Serine dehydratase beta chain |
| 12 | PF00293.30 | 0.95 | 19 | 4834.0 | opposite-strand | NUDIX domain |
| 13 | PF00425.20 | 0.95 | 19 | 5418.0 | opposite-strand | chorismate binding enzyme |
| 14 | PF04715.15 | 0.95 | 19 | 5418.0 | opposite-strand | Anthranilate synthase component I, N terminal region |
| 15 | PF02659.17 | 0.85 | 17 | 3937 | opposite-strand | Putative manganese efflux pump |