Result : P0DPO7

Protein Information

• Protein name: Protein YneP
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 1579545
• Right: 1579667
• Strand: +
• Nucleotide Sequence: ATGACGAAACACCCGACAGGAATTTATGTCGGGTGCCTTGTTAAGGTCATAAGAAGGAGGCTAAGAATGGAGTTAAAAGAGAGCGTTATTAATTATTCTCCATTTGTTTTGCAACATCCATAA
• Sequence: MTKHPTGIYVGCLVKVIRRRLRMELKESVINYSPFVLQHP
• Source of smORF: Swiss-Prot
• Pubmed ID: 9278503 29645342
• Functional Category: Others
• Uniprot ID: P0DPO7
• ORF Length (Amino Acid): 40

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2100926	2101048	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
2	1579545	1579667	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	1761866	1761988	-	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002695.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07715.17	1.0	2	1926	opposite-strand	TonB-dependent Receptor Plug Domain
2	PF06472.17	1.0	2	203	opposite-strand	ABC transporter transmembrane region 2
3	PF05992.14	1.0	2	203	opposite-strand	SbmA/BacA-like family
4	PF00005.29	1.0	2	230	opposite-strand	ABC transporter
5	PF04055.23	1.0	2	-34	opposite-strand	Radical SAM superfamily
6	PF13186.8	1.0	2	-34	opposite-strand	Iron-sulfur cluster-binding domain
7	PF00884.25	1.0	2	1175	opposite-strand	Sulfatase