Result : P0DPO4

Protein Information

• Protein name: Protein YnaM
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 1434293
• Right: 1434406
• Strand: -
• Nucleotide Sequence: ATGAACAGCATACTGATAATCACTTCGCTCCTTATCATATTCAGCATTTTTAGTCATGCTCTAATAAAATTAGGGATTGGCATATCCAATAACCCAGACAAAACCGATGTATAA
• Sequence: MNSILIITSLLIIFSIFSHALIKLGIGISNNPDKTDV
• Source of smORF: Swiss-Prot
• Pubmed ID: 9278503 29645342
• Functional Category: Others
• Uniprot ID: P0DPO4
• ORF Length (Amino Acid): 37

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1632890	1633003	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	1434293	1434406	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	2537943	2538047	-	NC_016845.1	Klebsiella pneumoniae subsp. pneumoniae HS11286
4	2653758	2653862	+	NZ_CP065838.1	Klebsiella quasipneumoniae

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_016845.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01432.22	0.67	2	3470.5	opposite-strand	Peptidase family M3
2	PF12833.9	0.67	2	4344	opposite-strand	Helix-turn-helix domain
3	PF00165.25	0.67	2	4344	opposite-strand	Bacterial regulatory helix-turn-helix proteins, AraC family
4	PF02586.16	0.67	2	929.0	same-strand	SOS response associated peptidase (SRAP)
5	PF00011.23	0.67	2	496.0	opposite-strand	Hsp20/alpha crystallin family
6	PF02464.19	0.67	2	1136.5	opposite-strand	Competence-damaged protein
7	PF00563.22	0.67	2	1669.5	same-strand	EAL domain
8	PF04940.14	0.67	2	1669.5	same-strand	Sensors of blue-light using FAD