ProsmORF-pred
Result : P0DPO4
Protein Information
Information Type Description
Protein name Protein YnaM
NCBI Accession ID U00096.3
Organism Escherichia coli (strain K12)
Left 1434293
Right 1434406
Strand -
Nucleotide Sequence ATGAACAGCATACTGATAATCACTTCGCTCCTTATCATATTCAGCATTTTTAGTCATGCTCTAATAAAATTAGGGATTGGCATATCCAATAACCCAGACAAAACCGATGTATAA
Sequence MNSILIITSLLIIFSIFSHALIKLGIGISNNPDKTDV
Source of smORF Swiss-Prot
Function
Pubmed ID 9278503 29645342
Domain
Functional Category Others
Uniprot ID P0DPO4
ORF Length (Amino Acid) 37
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 3
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1632890 1633003 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1434293 1434406 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2537943 2538047 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
4 2653758 2653862 + NZ_CP065838.1 Klebsiella quasipneumoniae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_016845.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01432.22 0.67 2 3470.5 opposite-strand Peptidase family M3
2 PF12833.9 0.67 2 4344 opposite-strand Helix-turn-helix domain
3 PF00165.25 0.67 2 4344 opposite-strand Bacterial regulatory helix-turn-helix proteins, AraC family
4 PF02586.16 0.67 2 929.0 same-strand SOS response associated peptidase (SRAP)
5 PF00011.23 0.67 2 496.0 opposite-strand Hsp20/alpha crystallin family
6 PF02464.19 0.67 2 1136.5 opposite-strand Competence-damaged protein
7 PF00563.22 0.67 2 1669.5 same-strand EAL domain
8 PF04940.14 0.67 2 1669.5 same-strand Sensors of blue-light using FAD
++ More..