Protein Information |
Information Type | Description |
---|---|
Protein name | Protein YnaL |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1409308 |
Right | 1409481 |
Strand | + |
Nucleotide Sequence | ATGACGACACTTATTTATTTGCAAATTCCTGTCCCTGAACCGATTCCTGGCGATCCTGTTCCAGTGCCCGATCCGATCCCTCGCCCGCAACCCATGCCTGACCCACCACCCGATGAAGAACCGATTAAATTGTCGCATCGTGAGCGTAGATCTGCGAGGATACGCGCCTGCTAA |
Sequence | MTTLIYLQIPVPEPIPGDPVPVPDPIPRPQPMPDPPPDEEPIKLSHRERRSARIRAC |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9278503 29645342 |
Domain | |
Functional Category | Others |
Uniprot ID | P0DPO3 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2348521 | 2348694 | - | NZ_LR134340.1 | Escherichia marmotae |
2 | 1865643 | 1865816 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 1409308 | 1409481 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
4 | 1918917 | 1919087 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 1449909 | 1450082 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 2291740 | 2291910 | - | NZ_CP061527.1 | Shigella dysenteriae |
7 | 666198 | 666371 | - | NZ_CP057657.1 | Escherichia fergusonii |
8 | 1749684 | 1749827 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
9 | 2741750 | 2741932 | - | NZ_CP043318.1 | Enterobacter chengduensis |
10 | 2482838 | 2483020 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
11 | 2491865 | 2492023 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
12 | 4755219 | 4755401 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
13 | 2527490 | 2527672 | - | NZ_AP022508.1 | Enterobacter bugandensis |
14 | 2510106 | 2510288 | - | NC_015968.1 | Enterobacter soli |
15 | 1369917 | 1370072 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
16 | 1075484 | 1075666 | - | NZ_CP038469.1 | Citrobacter tructae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01171.22 | 1.0 | 15 | 1466.5 | opposite-strand | PP-loop family |
2 | PF00270.31 | 0.93 | 14 | 29 | same-strand | DEAD/DEAH box helicase |
3 | PF00271.33 | 1.0 | 15 | 29.0 | same-strand | Helicase conserved C-terminal domain |
4 | PF03880.17 | 1.0 | 15 | 29.0 | same-strand | DbpA RNA binding domain |
5 | PF04851.17 | 0.93 | 14 | 29 | same-strand | Type III restriction enzyme, res subunit |
6 | PF01544.20 | 1.0 | 15 | 275.0 | same-strand | CorA-like Mg2+ transporter protein |
7 | PF00990.23 | 0.87 | 13 | 3013.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
8 | PF08448.12 | 0.87 | 13 | 3498.5 | opposite-strand | PAS fold |
9 | PF13426.9 | 0.87 | 13 | 3498.5 | opposite-strand | PAS domain |