Result : P0DPO3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YnaL |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1409308 |
| Right | 1409481 |
| Strand | + |
| Nucleotide Sequence | ATGACGACACTTATTTATTTGCAAATTCCTGTCCCTGAACCGATTCCTGGCGATCCTGTTCCAGTGCCCGATCCGATCCCTCGCCCGCAACCCATGCCTGACCCACCACCCGATGAAGAACCGATTAAATTGTCGCATCGTGAGCGTAGATCTGCGAGGATACGCGCCTGCTAA |
| Sequence | MTTLIYLQIPVPEPIPGDPVPVPDPIPRPQPMPDPPPDEEPIKLSHRERRSARIRAC |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 29645342 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0DPO3 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2348521 | 2348694 | - | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1865643 | 1865816 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1409308 | 1409481 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 1918917 | 1919087 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1449909 | 1450082 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2291740 | 2291910 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 666198 | 666371 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 1749684 | 1749827 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 2741750 | 2741932 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 10 | 2482838 | 2483020 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 11 | 2491865 | 2492023 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 12 | 4755219 | 4755401 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 13 | 2527490 | 2527672 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 14 | 2510106 | 2510288 | - | NC_015968.1 | Enterobacter soli |
| 15 | 1369917 | 1370072 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 16 | 1075484 | 1075666 | - | NZ_CP038469.1 | Citrobacter tructae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01171.22 | 1.0 | 15 | 1466.5 | opposite-strand | PP-loop family |
| 2 | PF00270.31 | 0.93 | 14 | 29 | same-strand | DEAD/DEAH box helicase |
| 3 | PF00271.33 | 1.0 | 15 | 29.0 | same-strand | Helicase conserved C-terminal domain |
| 4 | PF03880.17 | 1.0 | 15 | 29.0 | same-strand | DbpA RNA binding domain |
| 5 | PF04851.17 | 0.93 | 14 | 29 | same-strand | Type III restriction enzyme, res subunit |
| 6 | PF01544.20 | 1.0 | 15 | 275.0 | same-strand | CorA-like Mg2+ transporter protein |
| 7 | PF00990.23 | 0.87 | 13 | 3013.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 8 | PF08448.12 | 0.87 | 13 | 3498.5 | opposite-strand | PAS fold |
| 9 | PF13426.9 | 0.87 | 13 | 3498.5 | opposite-strand | PAS domain |
++ More..