ProsmORF-pred
Result : P0DPO0
Protein Information
Information Type Description
Protein name Protein YmgM
NCBI Accession ID U00096.3
Organism Escherichia coli (strain K12)
Left 1240260
Right 1240463
Strand +
Nucleotide Sequence ATGGACGACAAACAATTGCAGGCTCAGGCTGCGTTCAGCAAAGCATCGCAACCGGCGATAGATGCTTCATTAAATTTAAGATTCAGCTTCCTCTTCAGCCACCCGTACGCCAATCTTCAACACTTCATTATCTTCTTTCTCGGCCACCGTCCAGATCATCCCGGCAAACTCTACCTGGTCACCGACAACCGGTGCCGCGCCTAA
Sequence MDDKQLQAQAAFSKASQPAIDASLNLRFSFLFSHPYANLQHFIIFFLGHRPDHPGKLYLVTDNRCRA
Source of smORF Swiss-Prot
Function
Pubmed ID 9278503 29645342
Domain
Functional Category Others
Uniprot ID P0DPO0
ORF Length (Amino Acid) 67
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1240260 1240463 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1225761 1225961 + NC_004337.2 Shigella flexneri 2a str. 301
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF04293.15 1.0 2 3924.0 opposite-strand SpoVR like protein
2 PF01266.26 1.0 2 2296.0 same-strand FAD dependent oxidoreductase
3 PF01168.22 1.0 2 1216.0 same-strand Alanine racemase, N-terminal domain
4 PF00842.23 1.0 2 1216.0 same-strand Alanine racemase, C-terminal domain
5 PF00999.23 1.0 2 -128.0 opposite-strand Sodium/hydrogen exchanger family
6 PF02080.23 1.0 2 -128.0 opposite-strand TrkA-C domain
7 PF03471.19 1.0 2 -128.0 opposite-strand Transporter associated domain
8 PF17676.3 1.0 2 1703.0 opposite-strand LD-carboxypeptidase C-terminal domain
9 PF02016.17 1.0 2 1703.0 opposite-strand LD-carboxypeptidase N-terminal domain
10 PF01464.22 1.0 2 2693.5 same-strand Transglycosylase SLT domain
11 PF07317.14 1.0 2 3330.5 opposite-strand Flagellar regulator YcgR
12 PF07238.16 1.0 2 3330.5 opposite-strand PilZ domain
13 PF04226.15 1.0 2 4265.5 same-strand Transglycosylase associated protein
++ More..