| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YbgU |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 754674 |
| Right | 754781 |
| Strand | - |
| Nucleotide Sequence | ATGCGTAAAAGTTATGAAGTCGGTATTTCACCTAAGATTAACTTATGTAACAGTGTGGAAGTATTGACCAATTCATTCGGGACAGTTATTAGTGGTAGACAAGTTTAA |
| Sequence | MRKSYEVGISPKINLCNSVEVLTNSFGTVISGRQV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 29645342 30837344 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0DPN5 |
| ORF Length (Amino Acid) | 35 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 831320 | 831427 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 754674 | 754781 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 602272 | 602379 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2992213 | 2992320 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 744056 | 744163 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1385328 | 1385435 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 2256050 | 2256157 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 3456769 | 3456876 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 9 | 1436811 | 1436921 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 10 | 1459835 | 1459942 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 11 | 1448606 | 1448692 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 12 | 3759829 | 3759915 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 13 | 1539293 | 1539379 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 14 | 1628463 | 1628564 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 15 | 3245910 | 3246017 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 16 | 2592238 | 2592345 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 17 | 4122613 | 4122717 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00285.23 | 1.0 | 16 | 206 | same-strand | Citrate synthase, C-terminal domain |
| 2 | PF01127.24 | 1.0 | 16 | 559.5 | opposite-strand | Succinate dehydrogenase/Fumarate reductase transmembrane subunit |
| 3 | PF00890.26 | 1.0 | 16 | 1126 | opposite-strand | FAD binding domain |
| 4 | PF02910.22 | 1.0 | 16 | 1126 | opposite-strand | Fumarate reductase flavoprotein C-term |
| 5 | PF13085.8 | 1.0 | 16 | 2908 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 6 | PF13534.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF13183.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 1.0 | 16 | 2908 | opposite-strand | 4Fe-4S dicluster domain |
| 9 | PF02779.26 | 1.0 | 16 | 3925 | opposite-strand | Transketolase, pyrimidine binding domain |
| 10 | PF16870.7 | 1.0 | 16 | 3925 | opposite-strand | 2-oxoglutarate dehydrogenase C-terminal |
| 11 | PF00676.22 | 1.0 | 16 | 3925 | opposite-strand | Dehydrogenase E1 component |
| 12 | PF16078.7 | 1.0 | 16 | 3925 | opposite-strand | 2-oxoglutarate dehydrogenase N-terminus |