Result : A4X752
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000667.1 |
| Organism | Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) |
| Left | 2545801 |
| Right | 2546103 |
| Strand | + |
| Nucleotide Sequence | ATGGGTGCCCTCAGGCCATGGCACATCGCCGTACTCGTGGTCGTGCTGATCCTGCTCTTCGGCGCGAAGCGGCTCCCCGATGCGGCCCGCTCGCTGGGCCGTTCGCTGCGGATCATCAAGGCCGAGACGAAGAGCCTGCACGACGACGACCGTGACCTGGCCGAGAAGGCCGATGCCCAGGCGGGCTACCAGCCGATGCCACCGCAGGTCCAGCAGGGGCAGCACCCCCAGCAGTCACCCTACCCGGCCCCGCCGCAGCAGCAGCCGGTCGTTGACCCGGTGCAGCGCACCCGCGACAGCTGA |
| Sequence | MGALRPWHIAVLVVVLILLFGAKRLPDAARSLGRSLRIIKAETKSLHDDDRDLAEKADAQAGYQPMPPQVQQGQHPQQSPYPAPPQQQPVVDPVQRTRDS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 17563368 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | A4X752 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2545801 | 2546103 | + | NC_009380.1 | Salinispora tropica CNB-440 |
| 2 | 4375530 | 4375865 | + | NZ_CP058322.1 | Micromonospora carbonacea |
| 3 | 6072270 | 6072623 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 4 | 9364210 | 9364488 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 5 | 3838897 | 3839172 | - | NZ_AP022870.1 | Phytohabitans flavus |
| 6 | 2567301 | 2567543 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009380.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13280.8 | 1.0 | 6 | 734.5 | same-strand | WYL domain |
| 2 | PF19187.2 | 1.0 | 6 | 444.0 | same-strand | PafC helix-turn-helix domain |
| 3 | PF00902.20 | 1.0 | 6 | 47.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 4 | PF19279.1 | 0.83 | 5 | 1025 | same-strand | YegS C-terminal NAD kinase beta sandwich-like domain |
| 5 | PF00781.26 | 0.83 | 5 | 1025 | same-strand | Diacylglycerol kinase catalytic domain |
| 6 | PF00702.28 | 0.67 | 4 | 2142.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF08148.14 | 0.83 | 5 | 2855 | same-strand | DSHCT (NUC185) domain |
| 8 | PF00270.31 | 0.83 | 5 | 2855 | same-strand | DEAD/DEAH box helicase |
| 9 | PF04851.17 | 0.83 | 5 | 2855 | same-strand | Type III restriction enzyme, res subunit |
++ More..