Result : P0DPC8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YmcF |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1051684 |
| Right | 1051872 |
| Strand | + |
| Nucleotide Sequence | ATTACTCAACATCTCCATTTCCGCTGTCCATGTTGTCATGGTTCACAGTACCGCACATCGGCATTCGATGTGACGGAGCGAAACCCTTTGGGCGCTAAGTGTATTTTTTGTAAATCGACGATGATCACCTTTGATAACGTCGCGCTGCAAATACGCACTGACCATGCGCCGCTGGATTTCACAAAATAA |
| Sequence | MTQHLHFRCPCCHGSQYRTSAFDVTERNPLGAKCIFCKSTMITFDNVALQIRTDHAPLDFTK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 28861998 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0DPC8 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1709430 | 1709639 | + | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1039295 | 1039507 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1051660 | 1051872 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4164598 | 4164810 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 5 | 606103 | 606318 | - | NZ_CP033744.1 | Citrobacter freundii |
| 6 | 2079023 | 2079235 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 7 | 350729 | 350941 | + | NZ_CP038469.1 | Citrobacter tructae |
| 8 | 3377324 | 3377512 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 9 | 4172781 | 4172969 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 10 | 1300806 | 1300994 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 11 | 3942548 | 3942736 | - | NZ_CP041247.1 | Raoultella electrica |
| 12 | 3052537 | 3052725 | + | NZ_CP026047.1 | Raoultella planticola |
| 13 | 2566647 | 2566835 | + | NZ_CP050508.1 | Raoultella terrigena |
| 14 | 2297641 | 2297829 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
++ More..