Protein Information |
Information Type | Description |
---|---|
Protein name | rpoE leader peptide |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 2710009 |
Right | 2710164 |
Strand | - |
Nucleotide Sequence | ATGATCCGTCTACAGCATGACAAACAAAAACAGATGCGTTACGGAACTTTACAAAAACGAGACACTCTAACCCTTTGCTTGCTCAAATTGCAGCTAATGGAGTGGCGTTTCGATAGCGCGTGGAAATTTGGTTTGGGGAGACTTTACCTCGGATGA |
Sequence | MIRLQHDKQKQMRYGTLQKRDTLTLCLLKLQLMEWRFDSAWKFGLGRLYLG |
Source of smORF | Swiss-Prot |
Function | A short protein whose stop codon overlaps with the start codon of downstream rpoE; a premature stop codon at position 12 results in decreased expression of ECF sigma factor RpoE, thus they are translationally coupled (Pubmed:28924029). {ECO:0000269|Pubmed:28924029}. |
Pubmed ID | 9278503 28924029 |
Domain | |
Functional Category | Others |
Uniprot ID | P0DPC7 |
ORF Length (Amino Acid) | 51 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3430517 | 3430672 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 2710009 | 2710164 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2707223 | 2707378 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 4061598 | 4061753 | + | NZ_CP057657.1 | Escherichia fergusonii |
5 | 1003106 | 1003261 | + | NZ_CP061527.1 | Shigella dysenteriae |
6 | 3230584 | 3230739 | - | NZ_LR134340.1 | Escherichia marmotae |
7 | 2668611 | 2668766 | - | NZ_AP014857.1 | Escherichia albertii |
8 | 203066 | 203221 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
9 | 4666087 | 4666251 | + | NZ_CP038469.1 | Citrobacter tructae |
10 | 687096 | 687260 | - | NZ_CP053416.1 | Salmonella bongori |
11 | 2780003 | 2780167 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
12 | 3706978 | 3707142 | + | NZ_CP044098.1 | Citrobacter portucalensis |
13 | 1401519 | 1401683 | - | NZ_CP033744.1 | Citrobacter freundii |
14 | 5018632 | 5018787 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
15 | 1820270 | 1820425 | + | NZ_CP045205.1 | Citrobacter telavivensis |
16 | 2656636 | 2656776 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
17 | 949779 | 949916 | + | NZ_CP023525.1 | Cedecea neteri |
18 | 906767 | 906904 | + | NZ_LR134201.1 | Cedecea lapagei |
19 | 1492874 | 1493014 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00009.29 | 0.78 | 14 | 2885 | same-strand | Elongation factor Tu GTP binding domain |
2 | PF06421.14 | 0.78 | 14 | 2885 | same-strand | GTP-binding protein LepA C-terminus |
3 | PF00679.26 | 0.78 | 14 | 2885 | same-strand | Elongation factor G C-terminus |
4 | PF03144.27 | 0.78 | 14 | 2885 | same-strand | Elongation factor Tu domain 2 |
5 | PF01926.25 | 0.78 | 14 | 2885 | same-strand | 50S ribosome-binding GTPase |
6 | PF00071.24 | 0.72 | 13 | 2887.5 | same-strand | Ras family |
7 | PF04246.14 | 1.0 | 18 | 2207 | same-strand | Positive regulator of sigma(E), RseC/MucC |
8 | PF03888.16 | 1.0 | 18 | 1254 | same-strand | MucB/RseB N-terminal domain |
9 | PF17188.6 | 1.0 | 18 | 1254 | same-strand | MucB/RseB C-terminal domain |
10 | PF03872.15 | 1.0 | 18 | 604 | same-strand | Anti sigma-E protein RseA, N-terminal domain |
11 | PF03873.15 | 1.0 | 18 | 604 | same-strand | Anti sigma-E protein RseA, C-terminal domain |
12 | PF08281.14 | 1.0 | 18 | -3 | same-strand | Sigma-70, region 4 |
13 | PF04542.16 | 1.0 | 18 | -3 | same-strand | Sigma-70 region 2 |
14 | PF04545.18 | 1.0 | 18 | -3 | same-strand | Sigma-70, region 4 |
15 | PF07638.13 | 1.0 | 18 | -3 | same-strand | ECF sigma factor |
16 | PF00890.26 | 1.0 | 18 | 264 | opposite-strand | FAD binding domain |
17 | PF00270.31 | 1.0 | 18 | 2739 | opposite-strand | DEAD/DEAH box helicase |
18 | PF00271.33 | 1.0 | 18 | 2739 | opposite-strand | Helicase conserved C-terminal domain |
19 | PF04851.17 | 1.0 | 18 | 2739 | opposite-strand | Type III restriction enzyme, res subunit |
20 | PF13245.8 | 0.94 | 17 | 2739.0 | opposite-strand | AAA domain |